BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0200 (684 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24H6.11c |||sulfate transporter |Schizosaccharomyces pombe|c... 29 0.47 SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1||... 28 1.4 SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosa... 27 3.3 SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces p... 25 7.7 >SPAC24H6.11c |||sulfate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 958 Score = 29.5 bits (63), Expect = 0.47 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 429 VPNREEASERSPSPRTVVPKMAHRHQPSEKYCGAISEGKLHTDFLPD 569 +P REE S + P + V + PS+K G IS K++ F D Sbjct: 105 LPEREEHSSQLPPAQNQVLPFQSLNAPSKKLRGRISLSKIYQFFFDD 151 >SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 27.9 bits (59), Expect = 1.4 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = -1 Query: 261 DSISKRAVRQEVPYDEHETIRHAHVE*SENQTIVPDFVERFCDVEEESS 115 +S+ + + VP +HE I + +E+ T +P ++R C++ +ESS Sbjct: 275 NSLDNESCVRVVPSFDHEEIGSVSAQGAES-TFLPAVLQRICELGKESS 322 >SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosaccharomyces pombe|chr 3|||Manual Length = 877 Score = 26.6 bits (56), Expect = 3.3 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +2 Query: 254 IESREPAPPHDLSQLESRKALSSHPSYLAYSSTIFPGRRRPI*LYSPTTRLFT 412 + + PAPP+ + SS PS +S FP L+SPT R T Sbjct: 233 LSTSTPAPPNS-NNANPSTLFSSIPSSRHTTSNHFPSNSAQSSLFSPTARPLT 284 >SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 25.4 bits (53), Expect = 7.7 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 275 PPHDLSQLESRKALSSHPSYLAYSSTIFPGRRRPI*LYSPT 397 PPH+ SQ +S + PS+ + P +P + PT Sbjct: 508 PPHNYSQAQSPNLATPSPSFSSLPDVSLPPIVKPNLMSEPT 548 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,901,376 Number of Sequences: 5004 Number of extensions: 60355 Number of successful extensions: 173 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 173 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -