BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0197 (775 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.4 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 3.2 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 4.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 7.3 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 9.6 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.4 bits (48), Expect = 2.4 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -3 Query: 698 GRGRWYLPAG 669 G G+WYLP+G Sbjct: 236 GDGKWYLPSG 245 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 297 VPWHWCVYSKSNRPYLH 247 +P HW VY + N P LH Sbjct: 33 IPEHWLVYPEPN-PSLH 48 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 582 SWPRVVRAGVSESGFGFVASSCVNAVYWRSV 490 +W GV+ G G VAS +A W+S+ Sbjct: 907 TWSNSQVQGVAVPGSGIVASGQQHAGGWQSI 937 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 705 RNRQGAVVPTRGDSQEVLPPV 643 RN+QG GD ++PP+ Sbjct: 592 RNKQGHSARRSGDVAVIVPPI 612 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 9.6 Identities = 17/66 (25%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +2 Query: 470 VEEKLRATDRQ*TAFTHELATKPNPLSDTPALTTRGHDTTSRLVLLQRKTN-SINMIDFT 646 + +K++ T L + + P +T GH + LL N SI +F Sbjct: 117 ISKKIKKTMENKDITKRPLPNESQLIKRHPIVTIMGHVDHGKTTLLDALRNTSIAKSEF- 175 Query: 647 GGRTSC 664 GG T C Sbjct: 176 GGITQC 181 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,257 Number of Sequences: 438 Number of extensions: 4290 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -