BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0196 (778 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 26 1.1 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 26 1.5 AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 26 1.5 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 25 2.0 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 25 2.0 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 4.6 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 6.0 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 447 RGATQQVIDEAERSLHDALCVLAATV 524 R Q+VI + HDA+CVLA + Sbjct: 791 RPVVQRVISSFRTTSHDAVCVLAGMI 816 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +2 Query: 275 RYRKAWLGHWRGN--CVNI*LTRQSETWSLQIDRRGS 379 RY + W G W G V I +R ++W + + G+ Sbjct: 161 RYGEVWRGIWHGESVAVKIFFSRDEDSWKRETEIYGT 197 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +2 Query: 275 RYRKAWLGHWRGN--CVNI*LTRQSETWSLQID 367 R+ + W G WRG V I +R+ +WS + + Sbjct: 69 RFGEVWRGRWRGENVAVKIFSSREECSWSREAE 101 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 25.4 bits (53), Expect = 2.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 319 DTISPPVTKPSLSIPSKSACSIAITPASANN 227 D ++P + KPS+S PS++ S + +A N Sbjct: 142 DKLTPVLAKPSVSQPSRTHTSTNASSLNATN 172 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 25.4 bits (53), Expect = 2.0 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -1 Query: 469 ITCCVAPRITIVQAEPNATPEKRIKLSSPIRTSSINLQ*PS 347 IT V +++ + EPN TP + S I ++ + PS Sbjct: 164 ITIYVLFNVSLAELEPNFTPSHPVSFSEGIGNRTLYMSWPS 204 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 24.2 bits (50), Expect = 4.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 313 ISPPVTKPSLSIPSKSACSIAITPAS 236 IS + PS SIP + +IAIT AS Sbjct: 417 ISGDLKDPSSSIPKGTILAIAITSAS 442 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/28 (35%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +2 Query: 275 RYRKAWLGHWRGN--CVNI*LTRQSETW 352 RY + WL WR V I T + +W Sbjct: 269 RYGEVWLAKWRDEKVAVKIFFTTEESSW 296 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 735,940 Number of Sequences: 2352 Number of extensions: 13490 Number of successful extensions: 20 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -