BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0194 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21493| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_7424| Best HMM Match : AAA (HMM E-Value=0) 42 6e-04 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 41 8e-04 SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 38 0.007 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) 38 0.009 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 37 0.016 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 36 0.022 SB_732| Best HMM Match : AAA (HMM E-Value=0) 36 0.022 SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) 36 0.029 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 36 0.029 SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) 36 0.029 SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 36 0.038 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 34 0.087 SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) 33 0.27 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_34097| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 31 0.81 SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) 31 1.1 SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) 30 1.9 SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 29 3.3 SB_17427| Best HMM Match : ResIII (HMM E-Value=0.6) 29 3.3 SB_58373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) 29 4.3 SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) 29 4.3 SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17) 29 4.3 SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24) 28 5.7 SB_47632| Best HMM Match : AAA_5 (HMM E-Value=0.00038) 28 5.7 SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_16306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) 28 7.6 SB_41548| Best HMM Match : ResIII (HMM E-Value=0.27) 28 7.6 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 28 7.6 SB_12904| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_3314| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_21493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 73.3 bits (172), Expect = 2e-13 Identities = 32/57 (56%), Positives = 44/57 (77%) Frame = +1 Query: 211 RLQGIVVDMIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYS 381 R GI+++MI+ K+AGRA+L+AG PGTGKTAIA+ +AQ LG PF + GSE++S Sbjct: 153 RAAGIILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQSLGPDTPFTSIAGSEIFS 209 Score = 44.8 bits (101), Expect = 6e-05 Identities = 52/178 (29%), Positives = 81/178 (45%), Gaps = 2/178 (1%) Frame = +3 Query: 111 GISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGDSCRYDKK*E-NGRASFTLGR-A 284 G AHSHI+GLGLD+ Q++ G+VGQ +AR AAG K+ + GRA G+ Sbjct: 120 GGGAHSHIRGLGLDDALEARQVSQGMVGQVTARRAAGIILEMIKEGKIAGRAVLIAGQPG 179 Query: 285 SWYWQNCYSSCHRSGTWN*GSFLSNGW**SLQHSRSRKQRY*WENFRRAIGLRIPETKEV 464 + G + ++ SL+ S++ E+ L + ET E+ Sbjct: 180 TGKTAIAMGMAQSLGPDTPFTSIAGSEIFSLEMSKTEALTQPSES------LLVEET-EI 232 Query: 465 YEGEVTELTPVETENPAGGYGKTVSHVIIGLKTAKGTKQLKLDPPIYESFQRKRLKLG 638 EGEV E V+ + P G G V + LKT + L + ES +++++ G Sbjct: 233 IEGEVVE---VQIDRPTTGTGAKVGK--LTLKTTEMETIYDLGTKMIESLTKEKVQAG 285 >SB_7424| Best HMM Match : AAA (HMM E-Value=0) Length = 294 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 372 + +L+GPPGTGKT +A A+A E G VPF + GSE Sbjct: 82 KGAILSGPPGTGKTLLAKAVAGEAG--VPFLSISGSE 116 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 372 + LL GPPGTGKT +A A+A E VPF M GS+ Sbjct: 159 KGALLVGPPGTGKTLLAKAVATE--ADVPFLSMAGSD 193 >SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +1 Query: 223 IVVDMIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGT 339 ++ D + + R +L+ GPPGTGKT +A A+A E GT Sbjct: 271 LMPDYFQGIRRPWRGVLMVGPPGTGKTMLAKAVATECGT 309 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTADQEN 399 LL GPPG GKT +A AIA EL ++PF + +E+ S E+ Sbjct: 714 LLHGPPGCGKTLLAHAIAGEL--EMPFLKLAATEIVSGVSGES 754 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 37.9 bits (84), Expect = 0.007 Identities = 22/40 (55%), Positives = 25/40 (62%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYS 381 R +LL GP GTGKT IA A+A E G FC + G EV S Sbjct: 291 RGILLYGPSGTGKTMIARAVANETGVHF-FC-INGPEVLS 328 >SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) Length = 568 Score = 37.5 bits (83), Expect = 0.009 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 4/55 (7%) Frame = +1 Query: 184 VSWVKSLHV-RLQGIVVDMIRSKKMAG---RALLLAGPPGTGKTAIALAIAQELG 336 ++WV++ H R + + +K G +A LL+GPPG GKT A + QELG Sbjct: 242 LNWVRNWHKNRTKTLPKSSFFNKDTDGASLKAALLSGPPGVGKTTTATLVCQELG 296 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 37.1 bits (82), Expect = 0.012 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 7/56 (12%) Frame = +1 Query: 226 VVDMIRS----KKMAGR---ALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 372 VV+ +R+ K++ G+ +LL G PGTGKT +A A+A E G VPF GSE Sbjct: 146 VVEFLRNPEKFKRLGGKLPTGVLLIGSPGTGKTLLAKAVAGEAG--VPFFFCSGSE 199 >SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 36.7 bits (81), Expect = 0.016 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 375 +LLAGPPG GKT +A AIA E G + F + G E+ Sbjct: 20 ILLAGPPGCGKTLLAKAIANESG--INFISVKGPEL 53 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 36.7 bits (81), Expect = 0.016 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 375 +LLAGPPG GKT +A AIA E G + F + G E+ Sbjct: 20 ILLAGPPGCGKTLLAKAIANESG--INFISVKGPEL 53 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 36.3 bits (80), Expect = 0.022 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 372 R +LL GPPG GKT +A A+A T F +VGSE Sbjct: 199 RGVLLYGPPGCGKTMLAKAVAHH--TTAAFIRVVGSE 233 >SB_732| Best HMM Match : AAA (HMM E-Value=0) Length = 388 Score = 36.3 bits (80), Expect = 0.022 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = +1 Query: 226 VVDMIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVP 348 VVD + K + G +LL GPPGTGKT +A I L T+ P Sbjct: 173 VVDKMGLKHVKG--ILLFGPPGTGKTLMARQIGTMLNTREP 211 >SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) Length = 230 Score = 35.9 bits (79), Expect = 0.029 Identities = 21/47 (44%), Positives = 27/47 (57%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTADQENRGI 408 LL GPPGTGKT+ LA+A++L F GS V ++RGI Sbjct: 13 LLFYGPPGTGKTSTILAVAKQLYPDKQF----GSMVLELNASDDRGI 55 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 35.9 bits (79), Expect = 0.029 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYS 381 LLL GPPGTGKT +A +A+E G + F + G E+ S Sbjct: 704 LLLYGPPGTGKTLLAGVVAKECG--LNFISIKGPELLS 739 >SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) Length = 430 Score = 35.9 bits (79), Expect = 0.029 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +1 Query: 199 SLHVRLQGIVVDMIRSKKMAG--RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 372 +L L I + +K+ G R LL GPPGTGKT A ++A+ G + + M G + Sbjct: 307 NLEEHLSSISIATSNTKRNKGMYRNLLFYGPPGTGKTMFAKSLARHSG--MDYAVMTGGD 364 Query: 373 V 375 V Sbjct: 365 V 365 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 375 + +LL GPPGTGKT +A A+A T+ F + GSE+ Sbjct: 212 KGVLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 247 >SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3511 Score = 35.5 bits (78), Expect = 0.038 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = +1 Query: 208 VRLQGIVVDMIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTK 342 VR +V ++I++K R +LL GP GTGKT++A + Q+L K Sbjct: 1741 VRYDFLVYNLIQAK----RPVLLTGPVGTGKTSVAQKVLQKLDPK 1781 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 35.5 bits (78), Expect = 0.038 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 375 + +LL GPPGTGKT A A+A T F ++GSE+ Sbjct: 119 KGVLLFGPPGTGKTLCARAVANR--TDACFIRVIGSEL 154 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 35.1 bits (77), Expect = 0.050 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 375 + ++L G PGTGKT +A A+A + T F +VGSE+ Sbjct: 415 KGVILYGQPGTGKTLLAKAVANQ--TSATFLRVVGSEL 450 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 34.3 bits (75), Expect = 0.087 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG---TKVPFCPMVGSEVYS 381 R +L GPPGTGKT +A A+A E KV F G++ S Sbjct: 919 RGVLFFGPPGTGKTLVARALANECSQGDKKVSFFMRKGADCLS 961 >SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKV 345 + LL GPPG GKT +A IAQ G V Sbjct: 381 KVALLCGPPGLGKTTLAHVIAQHAGYNV 408 >SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) Length = 1199 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 265 ALLLAGPPGTGKTAIALAIAQELGTKV 345 A+L+ GP G GKTA A A ELG KV Sbjct: 640 AMLVVGPRGAGKTASIYACAGELGYKV 666 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQE 330 +LL GPPGTGKT +A A+A E Sbjct: 847 VLLYGPPGTGKTLMAKAVATE 867 >SB_34097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 31.9 bits (69), Expect = 0.47 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +1 Query: 265 ALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 372 A+L+ GP G GKTA A A ELG K C S+ Sbjct: 30 AMLVVGPRGAGKTASIYACAGELGYKDVECDTDASQ 65 >SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 31.1 bits (67), Expect = 0.81 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +1 Query: 274 LAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTADQE 396 + GP G+GKTA+ LA+ + L C +V +++++ D E Sbjct: 28 IGGPVGSGKTALVLALCKYLRDSCNIC-VVTNDIFTKEDWE 67 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 31.1 bits (67), Expect = 0.81 Identities = 19/55 (34%), Positives = 28/55 (50%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTADQENRGINGRIFD 426 + +L GPPG GKT +A AIA E + F + G E+ + E+ +FD Sbjct: 345 KGVLFYGPPGCGKTLLAKAIANE--CQANFISIKGPELLTMWFGESEANVRDVFD 397 >SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) Length = 420 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTADQEN 399 R LL GPPG GK++ A+A EL + C M S+ T D+ N Sbjct: 223 RGYLLYGPPGCGKSSFIQALAGELDYSI--CVMNLSDRSLTDDRLN 266 >SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 2065 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 256 AGRALLLAGPPGTGKTAIALAIAQELGTKVP 348 AG +LL GP G+GKT + +A G P Sbjct: 117 AGSGVLLEGPVGSGKTCLVEHVASMCGRSTP 147 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG 336 R +LL G PG GKT++ AIA+ G Sbjct: 1618 RPILLEGSPGVGKTSLVSAIAKASG 1642 >SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2077 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQEL 333 ++ GPPGTGKT I L +A+ L Sbjct: 875 VIQGPPGTGKTYIGLKVAKVL 895 >SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +1 Query: 256 AGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVY 378 + + +++ GP G GKTA+ +AI +E+ K + G+ + Sbjct: 506 SNQVVMVTGPVGCGKTALLMAILKEIPLKQGSVTLCGTVAF 546 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = -2 Query: 184 PAAI*IGTPFSSNPKPFI*L*AEIPLRFSCAFHFFNFHVESSFTLLNS 41 PA +G F S+PKP +E +C H FN H+ F N+ Sbjct: 629 PAFAKLGPLFRSSPKPAELTESETEYVVNCVKHVFNDHIVFQFDCTNT 676 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTK 342 +LL GPPG GKT + + Q L ++ Sbjct: 54 VLLTGPPGIGKTTLCSKVKQALASR 78 >SB_17427| Best HMM Match : ResIII (HMM E-Value=0.6) Length = 486 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +1 Query: 247 KKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPM 360 KK G +L ++G PGTGKTA + +++ +V CP+ Sbjct: 232 KKKPG-SLYISGAPGTGKTACLTMVIRDM-KEVSDCPV 267 >SB_58373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTK 342 +L+ G PGTGK+ + +A LG K Sbjct: 11 ILITGTPGTGKSTTGVELANRLGFK 35 >SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) Length = 1104 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 274 LAGPPGTGKTAIALAIAQEL 333 L GPPGTGKT L +A+ L Sbjct: 869 LEGPPGTGKTTSILCLARAL 888 >SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) Length = 609 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTKVPFC 354 +LL GP G+GKT +A IA+ L C Sbjct: 273 ILLLGPTGSGKTLLAQTIARCLDVPFAIC 301 >SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17) Length = 786 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 274 LAGPPGTGKTAIALAIAQEL 333 + GPPG GK+ +A+ +A EL Sbjct: 132 ITGPPGFGKSCVAIHVAHEL 151 >SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24) Length = 569 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 Query: 235 MIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYST 384 +I + G L + GP G GK+++ +AI EL + G YS+ Sbjct: 147 LIDNSYFKGELLAIVGPVGAGKSSLLMAILGELPFTEGTITVKGKIAYSS 196 >SB_47632| Best HMM Match : AAA_5 (HMM E-Value=0.00038) Length = 1172 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +1 Query: 265 ALLLAGPPGTGKTAIALAIAQEL 333 ++++AGPPGTGK++ A+ + L Sbjct: 1099 SIIVAGPPGTGKSSCISALIETL 1121 >SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +1 Query: 226 VVDMIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVY 378 V+ I K R + + GP G+GK+++ LAI E+ + G VY Sbjct: 263 VLSDITLKLKGSRLIGITGPCGSGKSSLLLAILNEMSLISGEAVVQGETVY 313 >SB_16306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 958 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 196 KSLHVRLQGI-VVDMIRSKKMAGRALLLAGPPGTGKTAIALAIA 324 K++ V + G ++ I K G L L GP G+GKT + +A Sbjct: 13 KNIGVSINGREILKTINGKVRPGEMLALMGPSGSGKTTLLNVLA 56 >SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) Length = 1264 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVG 366 ++L GP G GK+++ +AI E+ K F +G Sbjct: 589 VILTGPVGGGKSSLLMAILGEIPLKRGFIKAIG 621 >SB_41548| Best HMM Match : ResIII (HMM E-Value=0.27) Length = 514 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 253 MAGRALLLAGPPGTGKTAIALAIAQEL 333 ++ R ++ GPPG GKT + + I Q L Sbjct: 388 LSNRLAIVQGPPGCGKTFLGVKIVQLL 414 >SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) Length = 1345 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQEL 333 +++AGPPGTGK++ A+ + L Sbjct: 2 IIVAGPPGTGKSSCISALIETL 23 >SB_12904| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 27.9 bits (59), Expect = 7.6 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 145 GWMKMVFLFKWQPVSWV 195 G++K FLF+++P SWV Sbjct: 9 GYIKAYFLFEYEPTSWV 25 >SB_3314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 663 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 274 LAGPPGTGKTAIALAIAQELGTKVP 348 + GPPGTGKT +A+ I + P Sbjct: 590 VVGPPGTGKTDVAVQIISNIYHNFP 614 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,586,231 Number of Sequences: 59808 Number of extensions: 446080 Number of successful extensions: 1405 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 1315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1404 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -