BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0189 (601 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.0 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 4.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.0 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = +1 Query: 121 LAGVGYTYTSQSISEAVKKMQAFAGLPQTGVLDVPTKQLFKRKRC---GLKDIDED 279 L T T + AV TG +PT++L KR++ G D D+D Sbjct: 228 LPAASATGTGPATPSAVVATSNATAAMTTGTTTIPTRRLRKRRQNDGEGADDRDDD 283 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = +2 Query: 131 LATLTRHNLFPKLSRKCRPSQGYHKQ 208 L H L+P S C P G +Q Sbjct: 63 LTAQAHHRLYPAFSSSCDPVPGNLEQ 88 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 185 ACIFLTASEIDC 150 AC+ L AS IDC Sbjct: 10 ACLLLAASPIDC 21 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,326 Number of Sequences: 438 Number of extensions: 3959 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -