BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0188 (376 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY727913-1|AAV51404.1| 2472|Homo sapiens RIF1 isoform 4 protein. 29 4.9 AY727912-1|AAV51403.1| 2446|Homo sapiens RIF1 protein. 29 4.9 AY727911-1|AAV51402.1| 2446|Homo sapiens RIF1 protein. 29 4.9 AY727910-1|AAV51401.1| 2446|Homo sapiens RIF1 protein. 29 4.9 AY585745-1|AAT40745.1| 2472|Homo sapiens Rap1 interacting factor... 29 4.9 AY584066-1|AAS94233.1| 2472|Homo sapiens telomeric protein RIF1 ... 29 4.9 AK024033-1|BAB14792.1| 719|Homo sapiens protein ( Homo sapiens ... 29 4.9 AK022932-1|BAB14313.1| 838|Homo sapiens protein ( Homo sapiens ... 29 4.9 AF217994-1|AAG17236.1| 353|Homo sapiens unknown protein. 29 6.5 AY679523-1|AAT74623.1| 1512|Homo sapiens cell division cycle 2-l... 28 8.6 AK001461-1|BAA91705.1| 852|Homo sapiens protein ( Homo sapiens ... 28 8.6 AJ297710-1|CAC10401.1| 1452|Homo sapiens CDC2L5 protein kinase p... 28 8.6 AJ297709-1|CAC10400.1| 1512|Homo sapiens CDC2L5 protein kinase p... 28 8.6 AC072061-1|AAS07491.1| 784|Homo sapiens unknown protein. 28 8.6 >AY727913-1|AAV51404.1| 2472|Homo sapiens RIF1 isoform 4 protein. Length = 2472 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 23 NFSTIMQAITSPINNTFTELNISVSYNKIIL 115 NFS I A+T P+N+ F+E V+ K +L Sbjct: 675 NFSAIYGALTLPVNHIFSEQRFPVATMKTLL 705 >AY727912-1|AAV51403.1| 2446|Homo sapiens RIF1 protein. Length = 2446 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 23 NFSTIMQAITSPINNTFTELNISVSYNKIIL 115 NFS I A+T P+N+ F+E V+ K +L Sbjct: 675 NFSAIYGALTLPVNHIFSEQRFPVATMKTLL 705 >AY727911-1|AAV51402.1| 2446|Homo sapiens RIF1 protein. Length = 2446 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 23 NFSTIMQAITSPINNTFTELNISVSYNKIIL 115 NFS I A+T P+N+ F+E V+ K +L Sbjct: 675 NFSAIYGALTLPVNHIFSEQRFPVATMKTLL 705 >AY727910-1|AAV51401.1| 2446|Homo sapiens RIF1 protein. Length = 2446 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 23 NFSTIMQAITSPINNTFTELNISVSYNKIIL 115 NFS I A+T P+N+ F+E V+ K +L Sbjct: 675 NFSAIYGALTLPVNHIFSEQRFPVATMKTLL 705 >AY585745-1|AAT40745.1| 2472|Homo sapiens Rap1 interacting factor 1 protein. Length = 2472 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 23 NFSTIMQAITSPINNTFTELNISVSYNKIIL 115 NFS I A+T P+N+ F+E V+ K +L Sbjct: 675 NFSAIYGALTLPVNHIFSEQRFPVATMKTLL 705 >AY584066-1|AAS94233.1| 2472|Homo sapiens telomeric protein RIF1 protein. Length = 2472 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 23 NFSTIMQAITSPINNTFTELNISVSYNKIIL 115 NFS I A+T P+N+ F+E V+ K +L Sbjct: 675 NFSAIYGALTLPVNHIFSEQRFPVATMKTLL 705 >AK024033-1|BAB14792.1| 719|Homo sapiens protein ( Homo sapiens cDNA FLJ13971 fis, clone Y79AA1001541. ). Length = 719 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 23 NFSTIMQAITSPINNTFTELNISVSYNKIIL 115 NFS I A+T P+N+ F+E V+ K +L Sbjct: 28 NFSAIYGALTLPVNHIFSEQRFPVATMKTLL 58 >AK022932-1|BAB14313.1| 838|Homo sapiens protein ( Homo sapiens cDNA FLJ12870 fis, clone NT2RP2003727. ). Length = 838 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 23 NFSTIMQAITSPINNTFTELNISVSYNKIIL 115 NFS I A+T P+N+ F+E V+ K +L Sbjct: 499 NFSAIYGALTLPVNHIFSEQRFPVATMKTLL 529 >AF217994-1|AAG17236.1| 353|Homo sapiens unknown protein. Length = 353 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 322 KKKNSRGGPVPNS 360 KKKNSRGGPVP + Sbjct: 48 KKKNSRGGPVPGN 60 >AY679523-1|AAT74623.1| 1512|Homo sapiens cell division cycle 2-like 5 (cholinesterase-related cell division controller) protein. Length = 1512 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 277 SPSGGPRARLPTSAIKKKNSRGGPVPNSPYSES 375 SPS R R P+ + RGG V SPYS S Sbjct: 358 SPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSS 390 >AK001461-1|BAA91705.1| 852|Homo sapiens protein ( Homo sapiens cDNA FLJ10599 fis, clone NT2RP2004959. ). Length = 852 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 23 NFSTIMQAITSPINNTFTELNISVSYNKIIL 115 NFS I A+T P+N+ F+E V K +L Sbjct: 28 NFSAIYGALTLPVNHIFSEQRFPVPTMKTLL 58 >AJ297710-1|CAC10401.1| 1452|Homo sapiens CDC2L5 protein kinase protein. Length = 1452 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 277 SPSGGPRARLPTSAIKKKNSRGGPVPNSPYSES 375 SPS R R P+ + RGG V SPYS S Sbjct: 358 SPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSS 390 >AJ297709-1|CAC10400.1| 1512|Homo sapiens CDC2L5 protein kinase protein. Length = 1512 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 277 SPSGGPRARLPTSAIKKKNSRGGPVPNSPYSES 375 SPS R R P+ + RGG V SPYS S Sbjct: 358 SPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSS 390 >AC072061-1|AAS07491.1| 784|Homo sapiens unknown protein. Length = 784 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 277 SPSGGPRARLPTSAIKKKNSRGGPVPNSPYSES 375 SPS R R P+ + RGG V SPYS S Sbjct: 358 SPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSS 390 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,483,665 Number of Sequences: 237096 Number of extensions: 1344027 Number of successful extensions: 3103 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3103 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2479134298 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -