BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0188 (376 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 1.6 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 1.6 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 3.6 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 3.6 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 3.6 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 1.6 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 Query: 158 CFPNALTCPSSNETCGE 208 C P + CP N T GE Sbjct: 436 CLPEEILCPHFNVTDGE 452 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.6 bits (46), Expect = 1.6 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 349 PGPPSSFFFLLRL*ADEHAAHLMVSGYVTHGLQ--QCQGQSQAAA 221 P P SF F + A EH + + HGLQ G SQ +A Sbjct: 302 PPTPGSFNFSMAALATEHTPLSVKFPGMGHGLQPPDLAGTSQGSA 346 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.4 bits (43), Expect = 3.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 317 ALVGRRARGPPDGEWLRHPWTS 252 AL+ R R G W+ HP +S Sbjct: 65 ALMKERIRQKAAGHWVIHPCSS 86 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 3.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 317 ALVGRRARGPPDGEWLRHPWTS 252 AL+ R R G W+ HP +S Sbjct: 65 ALMKERIRQKAAGHWVIHPCSS 86 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 3.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 317 ALVGRRARGPPDGEWLRHPWTS 252 AL+ R R G W+ HP +S Sbjct: 65 ALMKERIRQKAAGHWVIHPCSS 86 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,003 Number of Sequences: 438 Number of extensions: 2636 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9052365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -