Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0187
         (381 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosacchar...    24   7.0  

>SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 988

 Score = 24.2 bits (50), Expect = 7.0
 Identities = 14/52 (26%), Positives = 24/52 (46%)
 Frame = +3

Query: 138 KYQKATEYVKKKD*RTSTLKLKVNKRSKERRHLHVILERNTFTASPLVTSRL 293
           K+Q  TE    K  +   L  + NK + E+ +   +  +NTF   P ++  L
Sbjct: 537 KHQLLTELEVSKRPKKPELPNQENKTTNEKVYRKPLSSQNTFDTLPTISQGL 588


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,232,483
Number of Sequences: 5004
Number of extensions: 20878
Number of successful extensions: 42
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 42
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42
length of database: 2,362,478
effective HSP length: 65
effective length of database: 2,037,218
effective search space used: 124270298
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)