BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0187 (381 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0327 - 23154014-23154942,23155169-23155316,23155606-231566... 29 1.6 10_08_0961 + 21869612-21869773,21869869-21869956,21870047-218702... 27 3.8 >03_05_0327 - 23154014-23154942,23155169-23155316,23155606-23156622, 23156753-23157217,23160258-23161247 Length = 1182 Score = 28.7 bits (61), Expect = 1.6 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 183 TSTLKLKVNKRSKERRHLHVILERN 257 T++LKLK NK+S ++H H + E N Sbjct: 851 TNSLKLKQNKKSARQKHHHGVPEGN 875 >10_08_0961 + 21869612-21869773,21869869-21869956,21870047-21870277, 21870371-21870538,21870808-21871001,21871151-21871234, 21871315-21871434,21871621-21871714,21871813-21871973, 21873237-21873313,21873738-21873932,21874487-21874559, 21874635-21874721,21874906-21875043,21875181-21875383, 21875469-21875631,21875861-21875992 Length = 789 Score = 27.5 bits (58), Expect = 3.8 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +3 Query: 210 KRSKERRHLHVILERNTFTAS----PLVTSRLTLGSSEREEEAN 329 K S E RHL + LER S L R GS+E+E E N Sbjct: 634 KSSSENRHLAISLERTMLEVSDAEKELKWLRSATGSAEKEYEIN 677 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,438,224 Number of Sequences: 37544 Number of extensions: 120172 Number of successful extensions: 203 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 203 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 624784784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -