BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0184 (705 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharom... 25 8.0 SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pom... 25 8.0 SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyce... 25 8.0 >SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 25.4 bits (53), Expect = 8.0 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 534 FKTRDATSKPIWIAEIDAIG-FFLNTCITASE 626 ++T++ + IW+ I +G +F NT T SE Sbjct: 236 YETQEQITASIWVEHISKLGYYFNNTSSTISE 267 >SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 992 Score = 25.4 bits (53), Expect = 8.0 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +1 Query: 310 CDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNA--SKAEASLAESG 459 CD+ + S G L H + R GG + + + N+ SK E +A SG Sbjct: 601 CDACLNLGTHSESIGDLEHQIRRYTGGISISPSAVTNNSDVSKYELGIAISG 652 >SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 25.4 bits (53), Expect = 8.0 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +1 Query: 382 AGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 507 A A+ +A A +AEA E+ K+++ EP+++ +K+ Sbjct: 89 AAEAEAAAAARAAAAKEAEAKRLEAAKNIVLKEPKDAPAAKK 130 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,941,682 Number of Sequences: 5004 Number of extensions: 59302 Number of successful extensions: 140 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -