BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0184 (705 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 31 0.74 At5g18830.2 68418.m02238 squamosa promoter-binding protein-like ... 30 1.3 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 4.0 At4g29310.1 68417.m04190 expressed protein 27 9.2 At4g27120.2 68417.m03898 expressed protein 27 9.2 At4g27120.1 68417.m03897 expressed protein 27 9.2 At1g59720.1 68414.m06720 pentatricopeptide (PPR) repeat-containi... 27 9.2 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 27 9.2 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 31.1 bits (67), Expect = 0.74 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +2 Query: 128 LACGSQAFIATLLFDPSMSALPIIAKQNSPSVGLFT 235 + C S + + LL P + L I+ QN P+VGLFT Sbjct: 1 MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 >At5g18830.2 68418.m02238 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 775 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 265 TVVRQVSFTLLMACRCDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGL-CLNASKAEA 441 T+V+++ L+ C CD + N +H ++ +K P AGL C +A+ Sbjct: 632 TLVKKMEPDSLVHCTCDCDVRLLHENMDLASDIHRKHQSPIESKDPEAGLDCKERIQADC 691 Query: 442 SLAESGKD 465 S GK+ Sbjct: 692 SPDSGGKE 699 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 5 RAKAGLIQMFSTHRDCESTAYRSFSIK 85 RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 291 RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At4g29310.1 68417.m04190 expressed protein Length = 424 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -1 Query: 180 IEGSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIK 19 I G K ++ ++ + + + CG SG K+ + D A LS+++ N W K Sbjct: 85 ISGKKISLRVSVYAGRTGHTCGVASGKLLGKVEVAVDLAAALSRTVAFHNGWKK 138 >At4g27120.2 68417.m03898 expressed protein Length = 298 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/72 (22%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +1 Query: 370 LGRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSK-QCDFTSRVSHSKRE 546 + RA GG ++ AS + +++ E+G + E+GG++ + +RE Sbjct: 47 VARAGGGRRMRRRPAASGASSSTSNVQENGSGSEDEDEDEAGGTQARASKKKEKKRQERE 106 Query: 547 TRRRSPFGSRRS 582 +R++ +R S Sbjct: 107 AQRQAEEATRES 118 >At4g27120.1 68417.m03897 expressed protein Length = 298 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/72 (22%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +1 Query: 370 LGRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSK-QCDFTSRVSHSKRE 546 + RA GG ++ AS + +++ E+G + E+GG++ + +RE Sbjct: 47 VARAGGGRRMRRRPAASGASSSTSNVQENGSGSEDEDEDEAGGTQARASKKKEKKRQERE 106 Query: 547 TRRRSPFGSRRS 582 +R++ +R S Sbjct: 107 AQRQAEEATRES 118 >At1g59720.1 68414.m06720 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 638 Score = 27.5 bits (58), Expect = 9.2 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = +1 Query: 322 TAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNASKAEASLAESGKDM 468 T Y S G LVH L A PSA N + SLAE+ DM Sbjct: 13 TITYYHPMSIGLLVHPLSPHIPPASSPSASTAGNHHQRIFSLAETCSDM 61 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 431 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 571 RPK P A + ++WSP S A + + +VA + A D+ +D Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,791,698 Number of Sequences: 28952 Number of extensions: 327916 Number of successful extensions: 782 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 767 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -