BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0181 (370 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC022034-1|AAH22034.1| 381|Homo sapiens lactate dehydrogenase A... 29 3.5 BC014340-1|AAH14340.1| 234|Homo sapiens LDHAL6A protein protein. 29 3.5 AY642121-1|AAT65080.1| 381|Homo sapiens lactacte dehydrogenase ... 29 3.5 AY581313-1|AAS93432.1| 332|Homo sapiens lactate dehydrogenase p... 29 3.5 AY009108-1|AAG49399.1| 381|Homo sapiens lactate dehydrogenase A... 29 3.5 AK131523-1|BAD18662.1| 332|Homo sapiens protein ( Homo sapiens ... 29 3.5 AK058192-1|BAB71710.1| 381|Homo sapiens protein ( Homo sapiens ... 29 3.5 BC142972-1|AAI42973.1| 230|Homo sapiens transient receptor pote... 28 8.2 BC134414-1|AAI34415.1| 230|Homo sapiens transient receptor pote... 28 8.2 BC121821-1|AAI21822.2| 230|Homo sapiens transient receptor pote... 28 8.2 BC094699-1|AAH94699.1| 323|Homo sapiens TRPM3 protein protein. 28 8.2 BC067733-1|AAH67733.1| 360|Homo sapiens TRPM3 protein protein. 28 8.2 BC022454-1|AAH22454.2| 370|Homo sapiens TRPM3 protein protein. 28 8.2 AL442645-7|CAM17597.1| 1711|Homo sapiens transient receptor pote... 28 8.2 AL442645-6|CAM17596.1| 1704|Homo sapiens transient receptor pote... 28 8.2 AL442645-5|CAM17595.1| 1322|Homo sapiens transient receptor pote... 28 8.2 AL442645-4|CAM17593.1| 1569|Homo sapiens transient receptor pote... 28 8.2 AL442645-3|CAM17594.1| 1566|Homo sapiens transient receptor pote... 28 8.2 AL442645-2|CAM17591.1| 1552|Homo sapiens transient receptor pote... 28 8.2 AL442645-1|CAM17592.1| 1579|Homo sapiens transient receptor pote... 28 8.2 AL391819-1|CAM23807.1| 1711|Homo sapiens transient receptor pote... 28 8.2 AL358786-7|CAM15783.1| 1711|Homo sapiens transient receptor pote... 28 8.2 AL358786-6|CAM15782.1| 1704|Homo sapiens transient receptor pote... 28 8.2 AL358786-5|CAM15781.1| 1322|Homo sapiens transient receptor pote... 28 8.2 AL358786-4|CAM15779.1| 1569|Homo sapiens transient receptor pote... 28 8.2 AL358786-3|CAM15780.1| 1566|Homo sapiens transient receptor pote... 28 8.2 AL358786-2|CAM15777.1| 1552|Homo sapiens transient receptor pote... 28 8.2 AL358786-1|CAM15778.1| 1579|Homo sapiens transient receptor pote... 28 8.2 AL356318-13|CAM13170.1| 1711|Homo sapiens transient receptor pot... 28 8.2 AL356318-12|CAM13169.1| 1704|Homo sapiens transient receptor pot... 28 8.2 AL356318-11|CAM13168.1| 1322|Homo sapiens transient receptor pot... 28 8.2 AL356318-9|CAM13167.1| 1569|Homo sapiens transient receptor pote... 28 8.2 AL356318-8|CAM13166.1| 1566|Homo sapiens transient receptor pote... 28 8.2 AL356318-6|CAI96096.1| 230|Homo sapiens transient receptor pote... 28 8.2 AL356318-5|CAI96097.2| 275|Homo sapiens transient receptor pote... 28 8.2 AL356318-4|CAM13165.1| 323|Homo sapiens transient receptor pote... 28 8.2 AL356318-2|CAM13163.1| 1552|Homo sapiens transient receptor pote... 28 8.2 AL356318-1|CAM13164.1| 1579|Homo sapiens transient receptor pote... 28 8.2 AL161913-2|CAM22746.1| 1704|Homo sapiens transient receptor pote... 28 8.2 AL161913-1|CAM22745.1| 1322|Homo sapiens transient receptor pote... 28 8.2 AL159990-11|CAM13097.1| 1711|Homo sapiens transient receptor pot... 28 8.2 AL159990-10|CAM13096.1| 1704|Homo sapiens transient receptor pot... 28 8.2 AL159990-9|CAM13095.1| 1322|Homo sapiens transient receptor pote... 28 8.2 AL159990-8|CAM13093.1| 1569|Homo sapiens transient receptor pote... 28 8.2 AL159990-7|CAM13094.1| 1566|Homo sapiens transient receptor pote... 28 8.2 AL159990-5|CAI12193.1| 230|Homo sapiens transient receptor pote... 28 8.2 AL159990-4|CAI12192.2| 275|Homo sapiens transient receptor pote... 28 8.2 AL159990-3|CAM13092.1| 323|Homo sapiens transient receptor pote... 28 8.2 AL159990-2|CAM13090.1| 1552|Homo sapiens transient receptor pote... 28 8.2 AL159990-1|CAM13091.1| 1579|Homo sapiens transient receptor pote... 28 8.2 AJ505026-1|CAD43605.1| 1325|Homo sapiens long transient receptor... 28 8.2 AJ505025-1|CAD43604.1| 1707|Homo sapiens long transient receptor... 28 8.2 AF536753-1|AAO49158.1| 1579|Homo sapiens calcium-permeable store... 28 8.2 AF536752-1|AAO49157.1| 1556|Homo sapiens calcium-permeable store... 28 8.2 AF536751-1|AAO49156.1| 1544|Homo sapiens calcium-permeable store... 28 8.2 AF536750-1|AAO49155.1| 1566|Homo sapiens calcium-permeable store... 28 8.2 AF536749-1|AAO49154.1| 1566|Homo sapiens calcium-permeable store... 28 8.2 AF536748-1|AAO49153.1| 1554|Homo sapiens calcium-permeable store... 28 8.2 AF325212-1|AAG42856.1| 338|Homo sapiens melastatin 2 protein. 28 8.2 AB099665-1|BAC55106.1| 1526|Homo sapiens hypothetical protein pr... 28 8.2 AB099664-1|BAC55105.1| 1579|Homo sapiens hypothetical protein pr... 28 8.2 AB099663-1|BAC55104.1| 1544|Homo sapiens hypothetical protein pr... 28 8.2 AB099662-1|BAC55103.1| 1569|Homo sapiens hypothetical protein pr... 28 8.2 AB099661-1|BAC55102.1| 1554|Homo sapiens hypothetical protein pr... 28 8.2 >BC022034-1|AAH22034.1| 381|Homo sapiens lactate dehydrogenase A-like 6B protein. Length = 381 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +3 Query: 57 ITVFPKR---SEGGSLVITKIRFFLRQTLPILLPSCDGSYSGAKGSYHI*IWS 206 ++ FPK G +L + RF + Q L I SC G G G + +WS Sbjct: 199 LSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWILGEHGDSSVPVWS 251 >BC014340-1|AAH14340.1| 234|Homo sapiens LDHAL6A protein protein. Length = 234 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = +3 Query: 66 FPKR---SEGGSLVITKIRFFLRQTLPILLPSCDGSYSGAKGSYHI*IWS 206 FPK G +L + R+F+ Q L I SC G G G + +WS Sbjct: 153 FPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWS 202 >AY642121-1|AAT65080.1| 381|Homo sapiens lactacte dehydrogenase protein. Length = 381 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +3 Query: 57 ITVFPKR---SEGGSLVITKIRFFLRQTLPILLPSCDGSYSGAKGSYHI*IWS 206 ++ FPK G +L + RF + Q L I SC G G G + +WS Sbjct: 199 LSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWILGEHGDSSVPVWS 251 >AY581313-1|AAS93432.1| 332|Homo sapiens lactate dehydrogenase protein. Length = 332 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = +3 Query: 66 FPKR---SEGGSLVITKIRFFLRQTLPILLPSCDGSYSGAKGSYHI*IWS 206 FPK G +L + R+F+ Q L I SC G G G + +WS Sbjct: 153 FPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWS 202 >AY009108-1|AAG49399.1| 381|Homo sapiens lactate dehydrogenase A protein. Length = 381 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +3 Query: 57 ITVFPKR---SEGGSLVITKIRFFLRQTLPILLPSCDGSYSGAKGSYHI*IWS 206 ++ FPK G +L + RF + Q L I SC G G G + +WS Sbjct: 199 LSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWILGEHGDSSVPVWS 251 >AK131523-1|BAD18662.1| 332|Homo sapiens protein ( Homo sapiens cDNA FLJ43406 fis, clone OCBBF2019823, highly similar to Homo sapiens lactate dehydrogenase A -like (LDHL). ). Length = 332 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = +3 Query: 66 FPKR---SEGGSLVITKIRFFLRQTLPILLPSCDGSYSGAKGSYHI*IWS 206 FPK G +L + R+F+ Q L I SC G G G + +WS Sbjct: 153 FPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWS 202 >AK058192-1|BAB71710.1| 381|Homo sapiens protein ( Homo sapiens cDNA FLJ25463 fis, clone TST09242. ). Length = 381 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +3 Query: 57 ITVFPKR---SEGGSLVITKIRFFLRQTLPILLPSCDGSYSGAKGSYHI*IWS 206 ++ FPK G +L + RF + Q L I SC G G G + +WS Sbjct: 199 LSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWILGEHGDSSVPVWS 251 >BC142972-1|AAI42973.1| 230|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 230 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >BC134414-1|AAI34415.1| 230|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 230 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >BC121821-1|AAI21822.2| 230|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 230 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >BC094699-1|AAH94699.1| 323|Homo sapiens TRPM3 protein protein. Length = 323 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >BC067733-1|AAH67733.1| 360|Homo sapiens TRPM3 protein protein. Length = 360 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 315 EGGPNVISIVLEYLRDTPPVPVVVCDGS 342 >BC022454-1|AAH22454.2| 370|Homo sapiens TRPM3 protein protein. Length = 370 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 305 EGGPNVISIVLEYLRDTPPVPVVVCDGS 332 >AL442645-7|CAM17597.1| 1711|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1711 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 340 EGGPNVISIVLEYLRDTPPVPVVVCDGS 367 >AL442645-6|CAM17596.1| 1704|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1704 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AL442645-5|CAM17595.1| 1322|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1322 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AL442645-4|CAM17593.1| 1569|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1569 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AL442645-3|CAM17594.1| 1566|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1566 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AL442645-2|CAM17591.1| 1552|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1552 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 184 EGGPNVISIVLEYLRDTPPVPVVVCDGS 211 >AL442645-1|CAM17592.1| 1579|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1579 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AL391819-1|CAM23807.1| 1711|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1711 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 340 EGGPNVISIVLEYLRDTPPVPVVVCDGS 367 >AL358786-7|CAM15783.1| 1711|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1711 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 340 EGGPNVISIVLEYLRDTPPVPVVVCDGS 367 >AL358786-6|CAM15782.1| 1704|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1704 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AL358786-5|CAM15781.1| 1322|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1322 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AL358786-4|CAM15779.1| 1569|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1569 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AL358786-3|CAM15780.1| 1566|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1566 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AL358786-2|CAM15777.1| 1552|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1552 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 184 EGGPNVISIVLEYLRDTPPVPVVVCDGS 211 >AL358786-1|CAM15778.1| 1579|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1579 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AL356318-13|CAM13170.1| 1711|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1711 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 340 EGGPNVISIVLEYLRDTPPVPVVVCDGS 367 >AL356318-12|CAM13169.1| 1704|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1704 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AL356318-11|CAM13168.1| 1322|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1322 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AL356318-9|CAM13167.1| 1569|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1569 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AL356318-8|CAM13166.1| 1566|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1566 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AL356318-6|CAI96096.1| 230|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 230 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AL356318-5|CAI96097.2| 275|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 275 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AL356318-4|CAM13165.1| 323|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 323 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AL356318-2|CAM13163.1| 1552|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1552 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 184 EGGPNVISIVLEYLRDTPPVPVVVCDGS 211 >AL356318-1|CAM13164.1| 1579|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1579 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AL161913-2|CAM22746.1| 1704|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1704 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AL161913-1|CAM22745.1| 1322|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1322 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AL159990-11|CAM13097.1| 1711|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1711 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 340 EGGPNVISIVLEYLRDTPPVPVVVCDGS 367 >AL159990-10|CAM13096.1| 1704|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1704 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AL159990-9|CAM13095.1| 1322|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1322 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AL159990-8|CAM13093.1| 1569|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1569 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AL159990-7|CAM13094.1| 1566|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1566 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AL159990-5|CAI12193.1| 230|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 230 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AL159990-4|CAI12192.2| 275|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 275 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AL159990-3|CAM13092.1| 323|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 323 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AL159990-2|CAM13090.1| 1552|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1552 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 184 EGGPNVISIVLEYLRDTPPVPVVVCDGS 211 >AL159990-1|CAM13091.1| 1579|Homo sapiens transient receptor potential cation channel, subfamily M, member 3 protein. Length = 1579 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AJ505026-1|CAD43605.1| 1325|Homo sapiens long transient receptor potential channel 3 protein. Length = 1325 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AJ505025-1|CAD43604.1| 1707|Homo sapiens long transient receptor potential channel 3 protein. Length = 1707 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 338 EGGPNVISIVLEYLRDTPPVPVVVCDGS 365 >AF536753-1|AAO49158.1| 1579|Homo sapiens calcium-permeable store-operated channel TRPM3f protein. Length = 1579 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AF536752-1|AAO49157.1| 1556|Homo sapiens calcium-permeable store-operated channel TRPM3e protein. Length = 1556 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AF536751-1|AAO49156.1| 1544|Homo sapiens calcium-permeable store-operated channel TRPM3d protein. Length = 1544 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AF536750-1|AAO49155.1| 1566|Homo sapiens calcium-permeable store-operated channel TRPM3c protein. Length = 1566 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AF536749-1|AAO49154.1| 1566|Homo sapiens calcium-permeable store-operated channel TRPM3b protein. Length = 1566 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AF536748-1|AAO49153.1| 1554|Homo sapiens calcium-permeable store-operated channel TRPM3a protein. Length = 1554 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AF325212-1|AAG42856.1| 338|Homo sapiens melastatin 2 protein. Length = 338 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 293 EGGPNVISIVLEYLRDTPPVPVVVCDGS 320 >AB099665-1|BAC55106.1| 1526|Homo sapiens hypothetical protein protein. Length = 1526 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AB099664-1|BAC55105.1| 1579|Homo sapiens hypothetical protein protein. Length = 1579 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AB099663-1|BAC55104.1| 1544|Homo sapiens hypothetical protein protein. Length = 1544 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 >AB099662-1|BAC55103.1| 1569|Homo sapiens hypothetical protein protein. Length = 1569 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 210 EGGPNVISIVLEYLRDTPPVPVVVCDGS 237 >AB099661-1|BAC55102.1| 1554|Homo sapiens hypothetical protein protein. Length = 1554 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 81 EGGSLVITKIRFFLRQTLPILLPSCDGS 164 EGG VI+ + +LR T P+ + CDGS Sbjct: 185 EGGPNVISIVLEYLRDTPPVPVVVCDGS 212 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,410,113 Number of Sequences: 237096 Number of extensions: 957739 Number of successful extensions: 1282 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 1247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1282 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2363825726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -