BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0177 (731 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pomb... 28 1.2 SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar... 26 6.4 SPAP8A3.14c |||mitochondrial inner membrane protein |Schizosacch... 25 8.4 >SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pombe|chr 3|||Manual Length = 1647 Score = 28.3 bits (60), Expect = 1.2 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 660 ISTFSDQFSRHYGFFLNLNRDVLE 731 +S+F D FSR + L+ N+DVLE Sbjct: 1494 VSSFIDAFSRAFSELLSSNKDVLE 1517 >SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 25.8 bits (54), Expect = 6.4 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = -3 Query: 609 SIKYFYLQTRTIHWLQLNYVRDFLISFFIFTFLVTFN 499 S+ +FY + ++++ Y+ F FF+F+F F+ Sbjct: 50 SLLFFYPKRNWWFFIKMRYLSFFFEFFFLFSFAFAFD 86 >SPAP8A3.14c |||mitochondrial inner membrane protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 677 Score = 25.4 bits (53), Expect = 8.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 38 MLK*NDLTVCTLEMFFHVIVFAS 106 ML D+T+C LEMFF ++ AS Sbjct: 167 MLAIKDVTLCPLEMFFLLLNNAS 189 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,411,707 Number of Sequences: 5004 Number of extensions: 42117 Number of successful extensions: 94 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -