BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0176 (743 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03340.1 68418.m00286 cell division cycle protein 48, putativ... 28 5.7 At1g14610.1 68414.m01737 valyl-tRNA synthetase / valine--tRNA li... 28 7.5 >At5g03340.1 68418.m00286 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; supporting cDNA gi|26449351|dbj|AK117125.1| Length = 810 Score = 28.3 bits (60), Expect = 5.7 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = +2 Query: 356 THYPLNIAHRPDILDIALLKNVTLRLHSIEVVSELDSDHRPVVMK--LGRAPDSVPVTRT 529 T + + +RPDI+D ALL+ RL + + D D R + K L ++P + V T Sbjct: 619 TVFIIGATNRPDIIDSALLR--PGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVT 676 Query: 530 VVDWHTLGISLAE 568 + +T G S A+ Sbjct: 677 ALAKYTQGFSGAD 689 >At1g14610.1 68414.m01737 valyl-tRNA synthetase / valine--tRNA ligase (VALRS) nearly identical to SP|P93736 Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase) (ValRS) {Arabidopsis thaliana} Length = 1108 Score = 27.9 bits (59), Expect = 7.5 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = +2 Query: 179 IVLSSDIEALLGMGSSVILAGDLNCKHVRWNTHTTTPNGRRLDALVDDLAFDI-----VA 343 IV ++ +E +LG + I D KH+ NGR+L + D + D Sbjct: 363 IVATTRVETMLGDTAIAIHPDDARYKHLHGKFAVHPFNGRKLPIICDGILVDPNFGTGCV 422 Query: 344 PLTPTHYP 367 +TP H P Sbjct: 423 KITPAHDP 430 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,472,924 Number of Sequences: 28952 Number of extensions: 298216 Number of successful extensions: 813 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -