BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0175 (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1596 + 34684943-34686340,34688085-34688175,34688290-346883... 30 2.0 07_03_1457 - 26674128-26674783,26675741-26675962,26676065-26676362 29 4.6 >04_04_1596 + 34684943-34686340,34688085-34688175,34688290-34688354, 34688530-34688581,34688747-34688829,34688942-34689035, 34689468-34690051 Length = 788 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +3 Query: 558 STYDNSFLQPLEL*KQACHQKNVGTDR*VHEHCIFGWRDR 677 S D F++ + +K+VG+D V C+FG+RD+ Sbjct: 406 SCADGGFVEKKRRPRMQSSRKSVGSDHLVVPECVFGFRDK 445 >07_03_1457 - 26674128-26674783,26675741-26675962,26676065-26676362 Length = 391 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 364 KQKTNSILCRVIISILSFGR*DSVILLFLDKTLLWVRALFRR 239 +Q+ + R + + FG D + LF +KTL WVR L R Sbjct: 172 EQERKEAMARSVFMVGEFGGNDYLHPLFQNKTLEWVRPLVPR 213 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,973,722 Number of Sequences: 37544 Number of extensions: 295657 Number of successful extensions: 477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -