BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0164 (494 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 22 3.5 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.1 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.1 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.8 bits (44), Expect = 3.5 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = -3 Query: 447 SPPDVKWLLEPIDIYNVNAATHFENEF*GLSIVTMAAPPFKPKR 316 +P DV+ +L + HF + + G ++T A P ++ +R Sbjct: 84 NPEDVELVLTDTKQNTKSFIYHFLHSWLGTGLLTSAGPKWQNRR 127 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.0 bits (42), Expect = 6.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 Query: 70 RCVFEILRYYYIHDFIIEK 14 RCV E+LR Y FI K Sbjct: 366 RCVKEVLRLYPSVHFISRK 384 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 6.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 Query: 70 RCVFEILRYYYIHDFIIEK 14 RCV E+LR Y FI K Sbjct: 366 RCVKEVLRLYPSVHFISRK 384 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,998 Number of Sequences: 336 Number of extensions: 1793 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11630247 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -