BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0164 (494 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe... 30 0.17 SPAPB2B4.05 |vma5||V-type ATPase subunit C|Schizosaccharomyces p... 25 6.3 >SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 30.3 bits (65), Expect = 0.17 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = -3 Query: 459 GRVHSPPDVKWLLEPIDIYN---VNAATHFENEF-*GLSIVTMAAPPFKPKRITALR 301 G +H P V WLL P DIY+ VN ++E G+S+V P +T LR Sbjct: 236 GPLHDPNTVMWLLRP-DIYSGRKVNVQIETQSELTMGMSVVDWWQVGLLPANVTFLR 291 >SPAPB2B4.05 |vma5||V-type ATPase subunit C|Schizosaccharomyces pombe|chr 1|||Manual Length = 394 Score = 25.0 bits (52), Expect = 6.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 375 SQNGWRHLRCICLW 416 S GW HL+C+C++ Sbjct: 295 SFQGWIHLKCLCVY 308 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,787,881 Number of Sequences: 5004 Number of extensions: 29638 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 194131776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -