BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0161 (725 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 101 4e-22 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 4e-22 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 96 2e-20 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 92 5e-19 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 89 4e-18 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 6e-17 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 61 8e-10 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 59 3e-09 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 59 3e-09 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 59 3e-09 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 54 9e-08 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 54 9e-08 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 53 2e-07 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 4e-07 SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 52 5e-07 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_8442| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 50 1e-06 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 50 1e-06 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 50 1e-06 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 50 1e-06 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 50 1e-06 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 50 1e-06 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 50 1e-06 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 50 1e-06 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 50 1e-06 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 50 1e-06 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 50 1e-06 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 50 1e-06 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 50 1e-06 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 50 1e-06 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 50 1e-06 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 50 1e-06 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 50 1e-06 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 50 1e-06 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 50 1e-06 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 50 1e-06 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 50 1e-06 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 50 1e-06 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 50 1e-06 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 50 1e-06 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 50 1e-06 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 50 1e-06 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 50 1e-06 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 50 1e-06 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 50 1e-06 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 50 1e-06 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 50 1e-06 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 50 1e-06 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 50 1e-06 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 50 1e-06 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 50 1e-06 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 50 1e-06 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 50 1e-06 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 50 1e-06 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 50 1e-06 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 50 1e-06 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 50 1e-06 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 50 1e-06 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 50 1e-06 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 50 1e-06 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 50 1e-06 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 50 1e-06 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 50 1e-06 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 50 1e-06 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 50 1e-06 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 50 1e-06 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 50 1e-06 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 50 1e-06 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 50 1e-06 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 50 1e-06 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 50 1e-06 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 50 1e-06 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 50 1e-06 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 50 1e-06 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 50 1e-06 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 50 1e-06 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 50 1e-06 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 50 1e-06 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 50 1e-06 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 50 1e-06 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 50 1e-06 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 50 1e-06 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 50 1e-06 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 50 1e-06 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 50 1e-06 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 101 bits (243), Expect = 4e-22 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = -3 Query: 723 ITPAGERGMCCKAIKLGNARVFPSHDVVKRRPVNCNTTHYRANW 592 ITPAGERGMCCKAIKLGNA VFPSHDVVKRRPVNCNTTHYRANW Sbjct: 10 ITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 101 bits (243), Expect = 4e-22 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = -3 Query: 723 ITPAGERGMCCKAIKLGNARVFPSHDVVKRRPVNCNTTHYRANW 592 ITPAGERGMCCKAIKLGNA VFPSHDVVKRRPVNCNTTHYRANW Sbjct: 24 ITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 100 bits (239), Expect = 1e-21 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 723 ITPAGERGMCCKAIKLGNARVFPSHDVVKRRPVNCNTTHYRANW 592 ITPAGERGMCCKAIKLGNA+ FPSHDVVKRRPVNCNTTHYRANW Sbjct: 16 ITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 96.3 bits (229), Expect = 2e-20 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -3 Query: 723 ITPAGERGMCCKAIKLGNARVFPSHDVVKRRPVNCNTTHYRANW 592 ITPAGERGMCCK+IKL +A VFPSHDVVKRRPVNCNTTHYRANW Sbjct: 18 ITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 91.9 bits (218), Expect = 5e-19 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = -3 Query: 723 ITPAGERGMCCKAIKLGNARVFPSHDVVKRRPVNCNTTHYRAN 595 ITPAGERGMCCKAIKLGNAR FPSHD KRRPVNCNTTHYRAN Sbjct: 55 ITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 89.8 bits (213), Expect = 2e-18 Identities = 40/44 (90%), Positives = 40/44 (90%) Frame = -3 Query: 723 ITPAGERGMCCKAIKLGNARVFPSHDVVKRRPVNCNTTHYRANW 592 ITPAGERGMCCKAIKL VFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1857 ITPAGERGMCCKAIKLVTP-VFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 88.6 bits (210), Expect = 4e-18 Identities = 42/60 (70%), Positives = 45/60 (75%) Frame = +1 Query: 544 GSTLKRKKKTRGGARYPIRPIVSRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 GS+ R T GGA PIRPIVSRITIHWP+FYN TG+ TQLNRLAAH PFASWRN Sbjct: 25 GSSCSRAAATDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRN 82 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 85.0 bits (201), Expect = 6e-17 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 610 SRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 SRITIHWPSFYNVVTG+NPGVTQLNRLAAH PFASWRN Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRN 39 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 83.4 bits (197), Expect = 2e-16 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -3 Query: 708 ERGMCCKAIKLGNARVFPSHDVVKRRPVNCNTTHYRAN 595 ERGMCCKAIKLGNA VF SHDVVKRRPVNCNTTHYRAN Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 81.8 bits (193), Expect = 5e-16 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 610 SRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 SRITIHWPSFYNVVTG+N GVTQLNRLAAH PFASWRN Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRN 39 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 81.8 bits (193), Expect = 5e-16 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 610 SRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 SRITIHWPSFYNVVTG+N GVTQLNRLAAH PFASWRN Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRN 39 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 80.6 bits (190), Expect = 1e-15 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = +1 Query: 610 SRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 SRITIHWPSFYNVV ENPGVTQLNRLAAH PFASWRN Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRN 39 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 78.6 bits (185), Expect = 5e-15 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = +1 Query: 595 IRPIVSRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 IRPIVSRITIHWPSFY ENPGV QLNRLAAH PFASWR+ Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRS 60 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 76.6 bits (180), Expect = 2e-14 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 610 SRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 SRITIHWPSFYNV+ + PGVTQLNRLAAH PFASWRN Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRN 39 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 76.2 bits (179), Expect = 3e-14 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 610 SRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 SRITIHWPSFYNVVTG+ VTQLNRLAAH PFASWRN Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRN 39 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 74.5 bits (175), Expect = 8e-14 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -3 Query: 723 ITPAGERGMCCKA-IKLGNARVFPSHDVVKRRPVNCNTTHYRANW 592 ITPAGE+G + +KLG + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 58 ITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 70.5 bits (165), Expect = 1e-12 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 720 TPAGERGMCCKAIKLGNARVFPSHDVVKRRPVNCNTTHYRANW 592 TP+G++ M ++ +A VFPSHDVVKRRPVNCNTTHYRANW Sbjct: 17 TPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 69.7 bits (163), Expect = 2e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 625 HWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 HWPSFYNVVTG+ GVTQLNRLAAH PFASWRN Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRN 37 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 607 VSRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 +SRITIHWPS ENPGVTQLNRLAAH PFASWRN Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRN 315 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 64.5 bits (150), Expect = 8e-11 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +1 Query: 610 SRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 SRITIHWPSFYNVVTG+ + L LAAH PFASWRN Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRN 39 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 61.3 bits (142), Expect = 8e-10 Identities = 36/60 (60%), Positives = 36/60 (60%) Frame = +1 Query: 544 GSTLKRKKKTRGGARYPIRPIVSRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 GST R T GGA PIRPIVS ITIHWPSFYN VT AH PFASWRN Sbjct: 27 GSTSSRAAATVGGA--PIRPIVSHITIHWPSFYNGVT-------------AHPPFASWRN 71 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 60.5 bits (140), Expect = 1e-09 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +1 Query: 610 SRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 SRITIHWPSFYNVVTG+ + L L H PFASWRN Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRN 39 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 660 FPSHDVVKRRPVNCNTTHYRANW 592 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 2 FPSHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 660 FPSHDVVKRRPVNCNTTHYRANW 592 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 58 FPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 660 FPSHDVVKRRPVNCNTTHYRANW 592 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 626 FPSHDVVKRRPVNCNTTHYRANW 648 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = -1 Query: 725 LLRQLAKGECAARRLSWVTPGFSPV 651 LLRQLAKG CAARRLSW P V Sbjct: 608 LLRQLAKGGCAARRLSWGFPSHDVV 632 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 640 YNVVTGENPGVTQLNRLAAHSPFASWRN 723 YNVVTG+ PGVTQLNRLAAH PFASWRN Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPFASWRN 39 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 660 FPSHDVVKRRPVNCNTTHYRANW 592 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 58 FPSHDVVKRRPVNCNTTHYRANW 80 Score = 48.0 bits (109), Expect = 8e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 725 LLRQLAKGECAARRLSWVTPGF 660 LLRQLAKG CAARRLSWVTPGF Sbjct: 37 LLRQLAKGGCAARRLSWVTPGF 58 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 660 FPSHDVVKRRPVNCNTTHYRANW 592 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 69 FPSHDVVKRRPVNCNTTHYRANW 91 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = -1 Query: 725 LLRQLAKGECAARRLSWVTPGFSPV 651 LLRQLAKG CAARRLSW P V Sbjct: 51 LLRQLAKGGCAARRLSWGFPSHDVV 75 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 660 FPSHDVVKRRPVNCNTTHYRANW 592 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 69 FPSHDVVKRRPVNCNTTHYRANW 91 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = -1 Query: 725 LLRQLAKGECAARRLSWVTPGFSPV 651 LLRQLAKG CAARRLSW P V Sbjct: 51 LLRQLAKGGCAARRLSWGFPSHDVV 75 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 699 MCCKAIKLGNARVFPSHDVVKRRPV 625 MCCKAIKLGNARVFPSHDVVKRRPV Sbjct: 1 MCCKAIKLGNARVFPSHDVVKRRPV 25 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = +1 Query: 610 SRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 SRITIHWPSFYNVVTG+ + L L PFASWRN Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRN 39 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 54.4 bits (125), Expect = 9e-08 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 7/55 (12%) Frame = +1 Query: 580 GARYPIRPIVSRITIHWPSFYNVVT-------GENPGVTQLNRLAAHSPFASWRN 723 G YP P SR H S+YN + ENPGVTQLNRLAAH PFASWRN Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRN 93 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 54.4 bits (125), Expect = 9e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 723 ITPAGERGMCCKAIKLGNARVFP 655 ITPAGERGMCCKAIKLGNARVFP Sbjct: 31 ITPAGERGMCCKAIKLGNARVFP 53 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -2 Query: 724 YYASWRKGNVLQGD*VG*RQGFPQSRRCKTTASEL 620 YYASWRKG+VLQG GF QSRRCKTTASEL Sbjct: 16 YYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/41 (63%), Positives = 29/41 (70%), Gaps = 7/41 (17%) Frame = +1 Query: 622 IHWPSFYNVVT-------GENPGVTQLNRLAAHSPFASWRN 723 IH+ S+YN + ENPGVTQLNRLAAH PFASWRN Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRN 1504 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 52.8 bits (121), Expect = 3e-07 Identities = 30/60 (50%), Positives = 32/60 (53%) Frame = +1 Query: 544 GSTLKRKKKTRGGARYPIRPIVSRITIHWPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 GST R T GGA PIRP + +NPGVT LNRL AH PFASWRN Sbjct: 40 GSTSSRAAATAGGA--PIRPYSESYYSSLAVGLQRLDWKNPGVTPLNRLEAHPPFASWRN 97 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 655 GENPGVTQLNRLAAHSPFASWRN 723 GENPGVTQLNRLAAH PFASWRN Sbjct: 38 GENPGVTQLNRLAAHPPFASWRN 60 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 651 HDVVKRRPVNCNTTHYRANW 592 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 52.4 bits (120), Expect = 4e-07 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 643 NVVTGENPGVTQLNRLAAHSPFASWRN 723 N VTG+ PGVTQLNRLAAH PFA+WRN Sbjct: 8 NDVTGKTPGVTQLNRLAAHPPFANWRN 34 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 651 HDVVKRRPVNCNTTHYRANW 592 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 52.0 bits (119), Expect = 5e-07 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +1 Query: 628 WPSFYNVVTGENPGVTQLNRLAAHSPFASWRN 723 WPS YN N GVTQLNRL AH PF SWRN Sbjct: 218 WPSIYNDRDWNNSGVTQLNRLVAHLPFVSWRN 249 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 52.0 bits (119), Expect = 5e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -3 Query: 699 MCCKAIKLGNARVFPSHDVVKRRPV 625 MC KAIKLGNA VFPSHDVVKRRPV Sbjct: 1 MCSKAIKLGNASVFPSHDVVKRRPV 25 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 51.6 bits (118), Expect = 6e-07 Identities = 25/39 (64%), Positives = 28/39 (71%), Gaps = 7/39 (17%) Frame = +1 Query: 628 WPSFYNVVTG-------ENPGVTQLNRLAAHSPFASWRN 723 + S+YN + G ENPGVTQLNRLAAH PFASWRN Sbjct: 45 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWRN 83 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 51.6 bits (118), Expect = 6e-07 Identities = 25/44 (56%), Positives = 31/44 (70%), Gaps = 3/44 (6%) Frame = +1 Query: 601 PIVSRITIHWPSFYNVVTG---ENPGVTQLNRLAAHSPFASWRN 723 P++ R+ ++ S V+ ENPGVTQLNRLAAH PFASWRN Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRN 93 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 51.6 bits (118), Expect = 6e-07 Identities = 25/39 (64%), Positives = 28/39 (71%), Gaps = 7/39 (17%) Frame = +1 Query: 628 WPSFYNVVTG-------ENPGVTQLNRLAAHSPFASWRN 723 + S+YN + G ENPGVTQLNRLAAH PFASWRN Sbjct: 58 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWRN 96 >SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 51.2 bits (117), Expect = 8e-07 Identities = 30/67 (44%), Positives = 36/67 (53%), Gaps = 14/67 (20%) Frame = +1 Query: 565 KKTRGGARYPIRPIVSRITIHWPS-------FYNVVT-------GENPGVTQLNRLAAHS 702 ++ + G R PI + R W S +YN + ENPGVTQLNRLAAH Sbjct: 43 REPKNGQRAPINDFLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHP 102 Query: 703 PFASWRN 723 PFASWRN Sbjct: 103 PFASWRN 109 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -2 Query: 724 YYASWRKGNVLQGD*VG*RQGFPQSRRCKTTASEL 620 YYASWRKG+VLQ GF QSRRCKTTASEL Sbjct: 16 YYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 Score = 32.7 bits (71), Expect = 0.31 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 707 KGECAARRLSWVTPGFS 657 KG+ RRLSWVTPGFS Sbjct: 22 KGDVLQRRLSWVTPGFS 38 >SB_8442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 50.8 bits (116), Expect = 1e-06 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 7/71 (9%) Frame = +1 Query: 532 ILQHGSTLKRKKKTRGGARYPIRPIVSRITIHWPSFYNVVT-------GENPGVTQLNRL 690 IL R ++ + RY S++++ S+YN + ENPGVTQLNRL Sbjct: 10 ILLRNDRKSRHRRIKKQRRYERLAATSQLSL-CESYYNSLAVVLQRRDWENPGVTQLNRL 68 Query: 691 AAHSPFASWRN 723 AAH PFASWRN Sbjct: 69 AAHPPFASWRN 79 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 45 ENPGVTQLNRLAAHPPFASWRN 66 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 25 ENPGVTQLNRLAAHPPFASWRN 46 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 72 ENPGVTQLNRLAAHPPFASWRN 93 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 54 ENPGVTQLNRLAAHPPFASWRN 75 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 46 ENPGVTQLNRLAAHPPFASWRN 67 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 72 ENPGVTQLNRLAAHPPFASWRN 93 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 77 ENPGVTQLNRLAAHPPFASWRN 98 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 48 ENPGVTQLNRLAAHPPFASWRN 69 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 68 ENPGVTQLNRLAAHPPFASWRN 89 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 80 ENPGVTQLNRLAAHPPFASWRN 101 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 56 ENPGVTQLNRLAAHPPFASWRN 77 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 45 ENPGVTQLNRLAAHPPFASWRN 66 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 35 ENPGVTQLNRLAAHPPFASWRN 56 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 60 ENPGVTQLNRLAAHPPFASWRN 81 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 69 ENPGVTQLNRLAAHPPFASWRN 90 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 63 ENPGVTQLNRLAAHPPFASWRN 84 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 79 ENPGVTQLNRLAAHPPFASWRN 100 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 67 ENPGVTQLNRLAAHPPFASWRN 88 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 50 ENPGVTQLNRLAAHPPFASWRN 71 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 50 ENPGVTQLNRLAAHPPFASWRN 71 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 226 ENPGVTQLNRLAAHPPFASWRN 247 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 121 ENPGVTQLNRLAAHPPFASWRN 142 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 59 ENPGVTQLNRLAAHPPFASWRN 80 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 38 ENPGVTQLNRLAAHPPFASWRN 59 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 26 ENPGVTQLNRLAAHPPFASWRN 47 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 57 ENPGVTQLNRLAAHPPFASWRN 78 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 391 ENPGVTQLNRLAAHPPFASWRN 412 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 117 ENPGVTQLNRLAAHPPFASWRN 138 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 93 ENPGVTQLNRLAAHPPFASWRN 114 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 49 ENPGVTQLNRLAAHPPFASWRN 70 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 18 ENPGVTQLNRLAAHPPFASWRN 39 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 28 ENPGVTQLNRLAAHPPFASWRN 49 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 48 ENPGVTQLNRLAAHPPFASWRN 69 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 113 ENPGVTQLNRLAAHPPFASWRN 134 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 55 ENPGVTQLNRLAAHPPFASWRN 76 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 350 ENPGVTQLNRLAAHPPFASWRN 371 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 90 ENPGVTQLNRLAAHPPFASWRN 111 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 60 ENPGVTQLNRLAAHPPFASWRN 81 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 26 ENPGVTQLNRLAAHPPFASWRN 47 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 69 ENPGVTQLNRLAAHPPFASWRN 90 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 53 ENPGVTQLNRLAAHPPFASWRN 74 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 144 ENPGVTQLNRLAAHPPFASWRN 165 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 73 ENPGVTQLNRLAAHPPFASWRN 94 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 49 ENPGVTQLNRLAAHPPFASWRN 70 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 153 ENPGVTQLNRLAAHPPFASWRN 174 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 843 ENPGVTQLNRLAAHPPFASWRN 864 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 567 KNSRGGPVXXXXXXXXXXXXLAVVLQRRDWGKP 665 K SRG P+ LAVVLQRRDW P Sbjct: 815 KPSRGDPLESTCRHASLA--LAVVLQRRDWENP 845 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 26 ENPGVTQLNRLAAHPPFASWRN 47 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 70 ENPGVTQLNRLAAHPPFASWRN 91 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 44 ENPGVTQLNRLAAHPPFASWRN 65 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 83 ENPGVTQLNRLAAHPPFASWRN 104 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 66 ENPGVTQLNRLAAHPPFASWRN 87 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 79 ENPGVTQLNRLAAHPPFASWRN 100 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 75 ENPGVTQLNRLAAHPPFASWRN 96 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 266 ENPGVTQLNRLAAHPPFASWRN 287 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 124 ENPGVTQLNRLAAHPPFASWRN 145 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 60 ENPGVTQLNRLAAHPPFASWRN 81 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 46 ENPGVTQLNRLAAHPPFASWRN 67 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 47 ENPGVTQLNRLAAHPPFASWRN 68 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 111 ENPGVTQLNRLAAHPPFASWRN 132 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 124 ENPGVTQLNRLAAHPPFASWRN 145 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 49 ENPGVTQLNRLAAHPPFASWRN 70 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 30 ENPGVTQLNRLAAHPPFASWRN 51 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 68 ENPGVTQLNRLAAHPPFASWRN 89 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 47 ENPGVTQLNRLAAHPPFASWRN 68 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 44 ENPGVTQLNRLAAHPPFASWRN 65 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 21 ENPGVTQLNRLAAHPPFASWRN 42 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 29 ENPGVTQLNRLAAHPPFASWRN 50 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 406 ENPGVTQLNRLAAHPPFASWRN 427 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 55 ENPGVTQLNRLAAHPPFASWRN 76 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 64 ENPGVTQLNRLAAHPPFASWRN 85 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 46 ENPGVTQLNRLAAHPPFASWRN 67 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 129 ENPGVTQLNRLAAHPPFASWRN 150 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 65 ENPGVTQLNRLAAHPPFASWRN 86 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 75 ENPGVTQLNRLAAHPPFASWRN 96 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 78 ENPGVTQLNRLAAHPPFASWRN 99 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 424 ENPGVTQLNRLAAHPPFASWRN 445 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 121 ENPGVTQLNRLAAHPPFASWRN 142 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 77 ENPGVTQLNRLAAHPPFASWRN 98 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 66 ENPGVTQLNRLAAHPPFASWRN 87 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 56 ENPGVTQLNRLAAHPPFASWRN 77 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 59 ENPGVTQLNRLAAHPPFASWRN 80 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 171 ENPGVTQLNRLAAHPPFASWRN 192 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 75 ENPGVTQLNRLAAHPPFASWRN 96 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 62 ENPGVTQLNRLAAHPPFASWRN 83 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 98 ENPGVTQLNRLAAHPPFASWRN 119 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 47 ENPGVTQLNRLAAHPPFASWRN 68 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 73 ENPGVTQLNRLAAHPPFASWRN 94 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 52 ENPGVTQLNRLAAHPPFASWRN 73 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 195 ENPGVTQLNRLAAHPPFASWRN 216 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 44 ENPGVTQLNRLAAHPPFASWRN 65 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 50 ENPGVTQLNRLAAHPPFASWRN 71 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 64 ENPGVTQLNRLAAHPPFASWRN 85 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 61 ENPGVTQLNRLAAHPPFASWRN 82 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 44 ENPGVTQLNRLAAHPPFASWRN 65 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 45 ENPGVTQLNRLAAHPPFASWRN 66 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 59 ENPGVTQLNRLAAHPPFASWRN 80 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 49 ENPGVTQLNRLAAHPPFASWRN 70 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 142 ENPGVTQLNRLAAHPPFASWRN 163 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 51 ENPGVTQLNRLAAHPPFASWRN 72 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 94 ENPGVTQLNRLAAHPPFASWRN 115 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 32 ENPGVTQLNRLAAHPPFASWRN 53 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 163 ENPGVTQLNRLAAHPPFASWRN 184 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 350 ENPGVTQLNRLAAHPPFASWRN 371 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 67 ENPGVTQLNRLAAHPPFASWRN 88 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 31 ENPGVTQLNRLAAHPPFASWRN 52 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 57 ENPGVTQLNRLAAHPPFASWRN 78 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 119 ENPGVTQLNRLAAHPPFASWRN 140 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 96 ENPGVTQLNRLAAHPPFASWRN 117 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 46 ENPGVTQLNRLAAHPPFASWRN 67 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 70 ENPGVTQLNRLAAHPPFASWRN 91 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 304 ENPGVTQLNRLAAHPPFASWRN 325 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 67 ENPGVTQLNRLAAHPPFASWRN 88 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 68 ENPGVTQLNRLAAHPPFASWRN 89 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 26 ENPGVTQLNRLAAHPPFASWRN 47 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 46 ENPGVTQLNRLAAHPPFASWRN 67 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 421 ENPGVTQLNRLAAHPPFASWRN 442 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 105 ENPGVTQLNRLAAHPPFASWRN 126 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 61 ENPGVTQLNRLAAHPPFASWRN 82 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 53 ENPGVTQLNRLAAHPPFASWRN 74 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 103 ENPGVTQLNRLAAHPPFASWRN 124 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 53 ENPGVTQLNRLAAHPPFASWRN 74 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 221 ENPGVTQLNRLAAHPPFASWRN 242 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 53 ENPGVTQLNRLAAHPPFASWRN 74 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 223 ENPGVTQLNRLAAHPPFASWRN 244 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 43 ENPGVTQLNRLAAHPPFASWRN 64 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 58 ENPGVTQLNRLAAHPPFASWRN 79 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 48 ENPGVTQLNRLAAHPPFASWRN 69 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 53 ENPGVTQLNRLAAHPPFASWRN 74 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 157 ENPGVTQLNRLAAHPPFASWRN 178 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 55 ENPGVTQLNRLAAHPPFASWRN 76 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 45 ENPGVTQLNRLAAHPPFASWRN 66 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 65 ENPGVTQLNRLAAHPPFASWRN 86 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 50 ENPGVTQLNRLAAHPPFASWRN 71 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 85 ENPGVTQLNRLAAHPPFASWRN 106 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 205 ENPGVTQLNRLAAHPPFASWRN 226 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 63 ENPGVTQLNRLAAHPPFASWRN 84 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 42 ENPGVTQLNRLAAHPPFASWRN 63 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 96 ENPGVTQLNRLAAHPPFASWRN 117 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 32 ENPGVTQLNRLAAHPPFASWRN 53 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 59 ENPGVTQLNRLAAHPPFASWRN 80 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 197 ENPGVTQLNRLAAHPPFASWRN 218 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 67 ENPGVTQLNRLAAHPPFASWRN 88 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 77 ENPGVTQLNRLAAHPPFASWRN 98 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 60 ENPGVTQLNRLAAHPPFASWRN 81 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 67 ENPGVTQLNRLAAHPPFASWRN 88 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 110 ENPGVTQLNRLAAHPPFASWRN 131 Score = 29.1 bits (62), Expect = 3.8 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +3 Query: 555 KTKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWGKP 665 +T K N+R G LAVVLQRRDW P Sbjct: 77 QTSKSNARAGD-PLESTCRHASLALAVVLQRRDWENP 112 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 86 ENPGVTQLNRLAAHPPFASWRN 107 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 106 ENPGVTQLNRLAAHPPFASWRN 127 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 83 ENPGVTQLNRLAAHPPFASWRN 104 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 50 ENPGVTQLNRLAAHPPFASWRN 71 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 59 ENPGVTQLNRLAAHPPFASWRN 80 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 673 ENPGVTQLNRLAAHPPFASWRN 694 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 58 ENPGVTQLNRLAAHPPFASWRN 79 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 47 ENPGVTQLNRLAAHPPFASWRN 68 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 38 ENPGVTQLNRLAAHPPFASWRN 59 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 156 ENPGVTQLNRLAAHPPFASWRN 177 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 48 ENPGVTQLNRLAAHPPFASWRN 69 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 69 ENPGVTQLNRLAAHPPFASWRN 90 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 98 ENPGVTQLNRLAAHPPFASWRN 119 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 46 ENPGVTQLNRLAAHPPFASWRN 67 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 110 ENPGVTQLNRLAAHPPFASWRN 131 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 53 ENPGVTQLNRLAAHPPFASWRN 74 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 1200 ENPGVTQLNRLAAHPPFASWRN 1221 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -1 Query: 725 LLRQLAKGECAARRLSW 675 LLRQLAKG CAARRLSW Sbjct: 423 LLRQLAKGGCAARRLSW 439 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 555 KTKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWGKP 665 K K+ S+G LAVVLQRRDW P Sbjct: 1166 KAGKRRSQGKGDPLESTCRHASLALAVVLQRRDWENP 1202 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 52 ENPGVTQLNRLAAHPPFASWRN 73 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 42 ENPGVTQLNRLAAHPPFASWRN 63 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 135 ENPGVTQLNRLAAHPPFASWRN 156 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 39 ENPGVTQLNRLAAHPPFASWRN 60 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 66 ENPGVTQLNRLAAHPPFASWRN 87 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 87 ENPGVTQLNRLAAHPPFASWRN 108 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 60 ENPGVTQLNRLAAHPPFASWRN 81 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 136 ENPGVTQLNRLAAHPPFASWRN 157 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 658 ENPGVTQLNRLAAHSPFASWRN 723 ENPGVTQLNRLAAH PFASWRN Sbjct: 178 ENPGVTQLNRLAAHPPFASWRN 199 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,679,617 Number of Sequences: 59808 Number of extensions: 470977 Number of successful extensions: 7934 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7917 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -