BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0161 (725 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g22180.1 68415.m02634 hydroxyproline-rich glycoprotein family... 29 4.1 At1g66030.1 68414.m07494 cytochrome P450-related weak similarity... 29 4.1 >At2g22180.1 68415.m02634 hydroxyproline-rich glycoprotein family protein Length = 291 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 205 RRSKHPVFKKKAKCSKTIIFYFI 273 +RSK+P KK CSK ++++FI Sbjct: 103 KRSKNPEKNKKKGCSKRLLWFFI 125 >At1g66030.1 68414.m07494 cytochrome P450-related weak similarity to cytochrome P450 [Catharanthus roseus] GI:4688670 Length = 167 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/33 (36%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = +3 Query: 9 LFGVAAM*VAFRICYLVFFYLLLRRA-NYLLFK 104 L G+ +AF +C+L+F+Y L+++ +Y+L K Sbjct: 3 LIGLIEAFIAF-VCFLIFYYFLIKKPYSYILIK 34 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,662,641 Number of Sequences: 28952 Number of extensions: 317710 Number of successful extensions: 629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1584903024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -