BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0160 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.6 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 2.1 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 2.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.8 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 3.7 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 4.8 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.5 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 257 GERAKLTCSPDYAYGQQGHPGVIPPNST 340 GER L S DY Y +G G +ST Sbjct: 1579 GERVMLKASEDYRYSVRGLCGNFDHDST 1606 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = -3 Query: 695 NVNKKYCDEITMTKCS*GM*VLSDKIESMIF 603 N +C+++++ + + M VLSD + ++F Sbjct: 342 NTTMVFCNDLSIDRSTNTMYVLSDNFQQLLF 372 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 194 FRIGKSEVIRGWDEGVAKMSVGERAKLTCSP 286 FRI E R W K+ + + KL C P Sbjct: 249 FRIQVDECDRLWILDSGKVDIAKGGKLACPP 279 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 2.8 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = -2 Query: 381 CIYSRRRSSTSKISVELGGMTPGWPC*P*A*SGEQVNLARSPTDIFATPSSQPRITSDFP 202 C R+ S S +E G P P + + +PT + ++P S+ + D P Sbjct: 568 CPRFRKLDSPSDSGIESGTEKPDKPA--------SSSASSAPTSVCSSPRSEDKEVEDMP 619 Query: 201 IL 196 +L Sbjct: 620 VL 621 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 Query: 669 NYNDKMLLRNVSVVR*NRIDDLQNFI 592 NYND +RN +V + +D Q ++ Sbjct: 160 NYNDPSNVRNCELVGLHDLDQSQEYV 185 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 663 NDKMLLRNVSVVR*NRIDDLQN 598 N K L+RN V N+ D++QN Sbjct: 404 NVKELIRNTHCVNNNQNDNIQN 425 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +2 Query: 113 TVVVHYTGTLTNGKKFDSSRDRGKPFKFRI 202 T + T+ NG + R+ KPF +I Sbjct: 461 TYFEQFDTTINNGLLLEEQRNDDKPFLIKI 490 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +2 Query: 113 TVVVHYTGTLTNGKKFDSSRDRGKPFKFRI 202 T + T+ NG + R+ KPF +I Sbjct: 461 TYFEQFDTTINNGLLLEEQRNDDKPFLIKI 490 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,621 Number of Sequences: 438 Number of extensions: 4689 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -