BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0156 (689 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70330.1 68414.m08091 equilibrative nucleoside transporter fa... 32 0.31 At1g63670.1 68414.m07205 expressed protein 30 1.7 At2g17820.1 68415.m02064 histidine kinase 1 99% identical to GP:... 29 2.9 At1g08890.1 68414.m00989 sugar transporter family protein simila... 29 3.8 At5g50070.1 68418.m06200 invertase/pectin methylesterase inhibit... 28 5.1 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 28 5.1 At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-g... 28 5.1 At5g12120.1 68418.m01423 ubiquitin-associated (UBA)/TS-N domain-... 28 6.7 At3g27840.1 68416.m03472 50S ribosomal protein L12-2, chloroplas... 27 8.9 >At1g70330.1 68414.m08091 equilibrative nucleoside transporter family protein contains similarity to SWISS-PROT:Q14542 equilibrative nucleoside transporter 2 (Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter, Equilibrative NBMPR-insensitive nucleoside transporter, Nucleoside transporter, ei-type, 36 kDa nucleolar protein HNP36, Hydrophobic nucleolar protein, 36 kDa, Delayed-early response protein 12) [Homo sapiens] Length = 450 Score = 32.3 bits (70), Expect = 0.31 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = -2 Query: 517 KDTLRGIAWRSSIWVVVNITRIFIRSIATVLFAVTEKTAFNASRVAASEEAILTEWF 347 K +L G+AWR+++W +V T++ VL + + F +LT+W+ Sbjct: 278 KGSLTGLAWRTTLWDIV--TKVKSHGFGIVLLYMVTLSIFPGYITEDVHSELLTDWY 332 >At1g63670.1 68414.m07205 expressed protein Length = 689 Score = 29.9 bits (64), Expect = 1.7 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 5/80 (6%) Frame = +2 Query: 446 DENSCDIDNDPNRAPPCDSSQCVLPDCFCSEDGTVIPGDLPARDVPQMITITFD----DA 613 + C+I +DP + S VL ED TVIPG++ ++ + I ++FD D Sbjct: 463 ERQDCNI-HDPKQEQEQPSPVSVLERIHL-EDETVIPGNVKISNLEEKIGLSFDDPNIDL 520 Query: 614 INNNNI-ELYKEIFNGKRKN 670 I ++ E K++ R N Sbjct: 521 IEKESVHEFVKKVLEASRLN 540 >At2g17820.1 68415.m02064 histidine kinase 1 99% identical to GP:4586626 Length = 1207 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 398 ERGLFCNGEKDCGDGSDENSCDIDNDPNRAPPCDS 502 +RGL CN ++ G+GSDE+ ++ DP + C S Sbjct: 935 KRGL-CNDLRNRGNGSDESHDCLEIDPTQFDTCSS 968 >At1g08890.1 68414.m00989 sugar transporter family protein similar to sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 464 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 324 ILRSLFLSLQFFTASFQSQVCFSISKNKPAGQRIAC---IPEAVHWM 193 +L+S +SL FFT +F ++ P G ++ C IPE+ W+ Sbjct: 160 LLQSFGISLMFFTGNFFHWRTLALLSAIPCGIQMICLFFIPESPRWL 206 >At5g50070.1 68418.m06200 invertase/pectin methylesterase inhibitor family protein low similarity to pollen-specific protein Bnm1 [Brassica napus] GI:1857671; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 183 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 284 AVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDS 388 A K+ N K +P L T+ CQ+ F++ GDS Sbjct: 82 AKKSASFANGAAKKEPSLKTQFQTCQEAFVSIGDS 116 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 464 YHKNFHQIHRHSPFRRYRKDRVQC 393 YH + H HS RR KDR +C Sbjct: 245 YHSHRSSAHTHSSHRRRSKDREEC 268 >At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-glucan glucanohydrolase, putative similar to SP|P17859 Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) {Vigna mungo}, alpha-amylase [Malus x domestica] GI:7532799; contains Pfam profile PF00128: Alpha amylase, catalytic domain Length = 887 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +3 Query: 21 WPRASCSPARLLMVTDGGDKLTRQQRKMKAWNKNYARTRTPANGSGWWPARATT 182 W A+ A VT G T Q K + W + + + P GWWP+RA T Sbjct: 717 WINATSGAAGAFDVTTKGILHTALQ-KCEYWRLSDPKGKPPGV-VGWWPSRAVT 768 >At5g12120.1 68418.m01423 ubiquitin-associated (UBA)/TS-N domain-containing protein contains Pfam profile PF00627: UBA/TS-N domain Length = 619 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 120 NYARTRTPANGSGWWPARATTVATSSNVLP 209 N + T A GSGW PA + A S+ LP Sbjct: 421 NASFTGAAAAGSGWHPANRSEAAQSNGYLP 450 >At3g27840.1 68416.m03472 50S ribosomal protein L12-2, chloroplast (CL12-B) identical to ribosomal protein L12 GB:X68046 [Arabidopsis thaliana] (J. Biol. Chem. 269 (10), 7330-7336 (1994)) Length = 193 Score = 27.5 bits (58), Expect = 8.9 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 288 TASFQSQVCFSISKNK-PAGQRIACIPEAVHWMTSRQLSPS 169 TAS + Q F + N P G RIA I A+ MTS LS S Sbjct: 117 TASVERQTTFDVVINDVPRGNRIAVIT-AIRAMTSLSLSES 156 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,698,737 Number of Sequences: 28952 Number of extensions: 324126 Number of successful extensions: 1120 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1082 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -