BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0155 (371 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 22 2.3 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 5.4 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.8 bits (44), Expect = 2.3 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 117 WVCPCDGGSRSINHQGFYYLPFYS 46 W+C + S + FYYLP S Sbjct: 49 WICALVNYNVSEISENFYYLPAMS 72 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 20.6 bits (41), Expect = 5.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 181 KWSNFNSSVVTQSCSRANAARKPFASCSQTI 273 K SN N ++CS A + +SC + I Sbjct: 183 KASNGNKCCCLRTCSSAKRPKFENSSCDEDI 213 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,025 Number of Sequences: 336 Number of extensions: 1625 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7722305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -