BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0152 (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20101| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_46833| Best HMM Match : MGS (HMM E-Value=1.5e-19) 28 8.4 >SB_20101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -3 Query: 188 SSGSV*NIELSSVLDEYTKFRVNLTKIMVS 99 SSGS N++L ++LD Y K R+NL+ ++S Sbjct: 123 SSGSRYNVQLENLLDFYGKKRLNLSDFLIS 152 >SB_46833| Best HMM Match : MGS (HMM E-Value=1.5e-19) Length = 648 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/41 (43%), Positives = 21/41 (51%) Frame = +1 Query: 361 FIIEFIVLYIFILIREAKICADGGV*NFLHLYRI*GRSVNA 483 FI FIVLY+F+ KI G L LY I GR + A Sbjct: 566 FITFFIVLYLFLKFVFIKIEVIGKKKTVLMLYNISGRHLRA 606 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,953,958 Number of Sequences: 59808 Number of extensions: 252614 Number of successful extensions: 558 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -