BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0151 (492 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9XY92 Cluster: Spermidine synthase; n=14; Eukaryota|Re... 35 0.86 UniRef50_Q8TB69 Cluster: Zinc finger protein 519; n=5; Homo/Pan/... 32 6.0 >UniRef50_Q9XY92 Cluster: Spermidine synthase; n=14; Eukaryota|Rep: Spermidine synthase - Dictyostelium discoideum (Slime mold) Length = 284 Score = 35.1 bits (77), Expect = 0.86 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 329 MDKLKTNWFTESCDMWPGGYFLIPSQRSTAPEKS 430 MDK++ WF+E + WPG F + ++ EKS Sbjct: 1 MDKIQNGWFSEISEFWPGNSFSLEVEKVLHHEKS 34 >UniRef50_Q8TB69 Cluster: Zinc finger protein 519; n=5; Homo/Pan/Gorilla group|Rep: Zinc finger protein 519 - Homo sapiens (Human) Length = 540 Score = 32.3 bits (70), Expect = 6.0 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -1 Query: 225 CIPCSKYKNSFRPSYELNITELTFHNHDIYVQRYDSIH 112 CIP +KY++ F S N ++ F NHD + ++ S H Sbjct: 139 CIPMNKYQHKFLKSVFCNKNQINF-NHDSDISKHHSTH 175 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,704,526 Number of Sequences: 1657284 Number of extensions: 9635965 Number of successful extensions: 20052 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20051 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 28437262108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -