BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0151 (492 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 23 4.3 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 7.5 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 23.4 bits (48), Expect = 4.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 349 LVYGIMRYVAWGVLSHSKSKK 411 L Y + Y WG + KSKK Sbjct: 301 LEYAAVNYTYWGARAKKKSKK 321 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 22.6 bits (46), Expect = 7.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 276 KQVLTLSFGLYNLTFK*CIPCSKYKNSFRPSY 181 K++L L ++ LT+K + S +K PSY Sbjct: 235 KKILGLVRNIFELTYKLDVEMSLWKYISTPSY 266 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 506,488 Number of Sequences: 2352 Number of extensions: 9841 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -