BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0147 (789 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0101 - 766382-767487,767599-767756,767900-768615 35 0.064 07_03_0902 - 22435692-22436156,22436684-22436923,22437228-224373... 29 5.6 01_07_0106 - 41107673-41107942,41108362-41108574,41108877-411090... 29 5.6 01_05_0553 + 23185473-23186188,23187096-23187101,23187230-231873... 28 7.4 >01_01_0101 - 766382-767487,767599-767756,767900-768615 Length = 659 Score = 35.1 bits (77), Expect = 0.064 Identities = 14/63 (22%), Positives = 35/63 (55%) Frame = +2 Query: 20 KNNSADIALYDHSIYSCIIPLDNSINRILMNTYIIICSVVIHIYFNVYICNYISVQICMY 199 K A+IA+ D +SC + D S N ++ TY+++ + ++ + + +C ++ + ++ Sbjct: 246 KERIANIAIIDFYFWSCFLLGDRSHNNLIY-TYMVVDTALLILKWTAVLCRFVLAPLAVF 304 Query: 200 WFM 208 F+ Sbjct: 305 IFL 307 >07_03_0902 - 22435692-22436156,22436684-22436923,22437228-22437349, 22437441-22437587,22437753-22437882,22437981-22438116, 22438223-22438428,22438644-22438844,22438999-22439157, 22439781-22439858,22440453-22440542,22440625-22440777, 22440873-22440991,22441190-22441328,22441422-22441525, 22441944-22441989,22442087-22442252,22442356-22442383, 22442460-22442610,22442686-22442829,22442912-22443013, 22443566-22444093 Length = 1217 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/59 (23%), Positives = 29/59 (49%) Frame = -1 Query: 786 WFIPVNQLPSGHPTK*CKAQKPICSHNIQTTSAHYVKCTGMHGNAKPLIDMCNLISHRM 610 W V+ TK KAQ ++ T+ H+++C + +P++ +L+SH++ Sbjct: 720 WHSAVDSQKQSVVTK-FKAQLFKLMQQLENTTPHFIRCIQPNSKQRPMLFEHDLVSHQL 777 >01_07_0106 - 41107673-41107942,41108362-41108574,41108877-41109041, 41109431-41109649,41110205-41110324,41110427-41110489, 41111034-41111606,41111691-41111858,41112414-41112495, 41112667-41112743,41113031-41113101,41114315-41114363 Length = 689 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = -1 Query: 552 NLIGLGNKYFGSKLVITLYSTKQLGQILARSQNCISLRSGALMAYLKGIYVD 397 +L+ N+Y K I + T G + R +NCI + +LKGI D Sbjct: 28 HLVNKSNEYVAFKNYIVMLDTYLYGNLTRRLENCI-FNARLKQHHLKGIVFD 78 >01_05_0553 + 23185473-23186188,23187096-23187101,23187230-23187374, 23187887-23188159,23188275-23188338,23188479-23188744, 23188951-23189045,23189544-23189718,23190669-23191063, 23191830-23191953,23192864-23192959,23193049-23193120, 23194687-23194824,23195369-23195549,23195602-23195963, 23196944-23197386,23197461-23197763,23197857-23198081, 23198260-23198350,23198702-23198779,23198939-23199229, 23199316-23199513,23199681-23200163,23200488-23200562, 23201163-23201324,23201400-23201729,23201816-23201916, 23202477-23202581,23202931-23203162,23203913-23204257, 23204346-23204447,23206010-23206153,23206463-23206551, 23206979-23207061,23207172-23207287,23207824-23207909, 23208461-23208560,23209270-23209335 Length = 2451 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 735 KAQKPICSHNIQTTSAHYVKCTGMHGNAKPLIDMC 631 K+ I S + YV +H NA P++DMC Sbjct: 2409 KSAFQIASRSGSVADVQYVAHQALHANALPVLDMC 2443 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,925,013 Number of Sequences: 37544 Number of extensions: 365056 Number of successful extensions: 546 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2127163404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -