BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0147 (789 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45306| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_47780| Best HMM Match : CBM_3 (HMM E-Value=1.8) 28 7.5 >SB_45306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1576 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +2 Query: 38 IALYDHSIYSCIIPLDNSINRILMNTYIII-CSVVIHIYFNVYICNYISVQICMYWFMV 211 + LY S Y I+ L +++ IL++ Y I C V+H+ + + + + C Y++ V Sbjct: 444 LLLYRASRYYYIVHLAITMSCILLSLYRAIRCYYVVHVAITISCKSLVLCRACRYYYFV 502 >SB_47780| Best HMM Match : CBM_3 (HMM E-Value=1.8) Length = 597 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 385 MNSPRKVNINHVHFNKTQ**RTCKF-YLFLNLLSRINAFMSH 263 +N+ + VN++++H N +Q R K Y+ LN +N H Sbjct: 166 LNTSQAVNVSYMHLNTSQAIRAVKVSYMHLNTSQAVNVSYMH 207 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,435,985 Number of Sequences: 59808 Number of extensions: 479530 Number of successful extensions: 866 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -