BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0147 (789 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 25 3.5 U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. 24 4.7 U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. 24 4.7 U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. 24 4.7 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 4.7 CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. 23 8.1 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 257 TINLPKIPQRHIFTEIP*TSTYISVHL 177 T + P P R FTE+P T + HL Sbjct: 793 TPDKPDFPYRKEFTELPDTIELVDAHL 819 >U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 24.2 bits (50), Expect = 4.7 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = -3 Query: 625 NFTSDESASKNSFKPKNYRLILVIKFNWTR*QIFWVETCYN 503 ++ DE+ SK Y + I NW + W T YN Sbjct: 53 SYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN 93 >U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 24.2 bits (50), Expect = 4.7 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = -3 Query: 625 NFTSDESASKNSFKPKNYRLILVIKFNWTR*QIFWVETCYN 503 ++ DE+ SK Y + I NW + W T YN Sbjct: 53 SYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN 93 >U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 24.2 bits (50), Expect = 4.7 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = -3 Query: 625 NFTSDESASKNSFKPKNYRLILVIKFNWTR*QIFWVETCYN 503 ++ DE+ SK Y + I NW + W T YN Sbjct: 53 SYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN 93 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 24.2 bits (50), Expect = 4.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 136 CYTYLF*CIYM*LYKCTDMYVLVHGIS 216 CYT+ F C+Y+ +Y L+ IS Sbjct: 229 CYTFTFICLYLFFIITLSIYGLMSQIS 255 >CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. Length = 376 Score = 23.4 bits (48), Expect = 8.1 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -3 Query: 622 FTSDESASKNSFKPKNYRLILVIKFNWTR*QIFWVETCYN 503 + DE+ SK Y + I NW + W T YN Sbjct: 54 YVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYN 93 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 821,689 Number of Sequences: 2352 Number of extensions: 17655 Number of successful extensions: 20 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -