BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0147 (789 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28739-7|AAB93458.1| 681|Caenorhabditis elegans Cell division c... 29 5.0 U28739-3|AAB93459.1| 1063|Caenorhabditis elegans Cell division c... 29 5.0 AY661745-1|AAT74544.1| 681|Caenorhabditis elegans CDC-14 phosph... 29 5.0 AY661744-1|AAT74543.1| 1063|Caenorhabditis elegans CDC-14 phosph... 29 5.0 AF000363-1|AAB94407.1| 681|Caenorhabditis elegans protein phosp... 29 5.0 >U28739-7|AAB93458.1| 681|Caenorhabditis elegans Cell division cycle related protein14, isoform c protein. Length = 681 Score = 28.7 bits (61), Expect = 5.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 732 AQKPICSHNIQTTSAHYVKCTGMHGNAKPL 643 ++ P+ HN TT + G++G+ KPL Sbjct: 630 SRAPLSPHNYSTTQGYSTSSRGLYGDKKPL 659 >U28739-3|AAB93459.1| 1063|Caenorhabditis elegans Cell division cycle related protein14, isoform b protein. Length = 1063 Score = 28.7 bits (61), Expect = 5.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 732 AQKPICSHNIQTTSAHYVKCTGMHGNAKPL 643 ++ P+ HN TT + G++G+ KPL Sbjct: 630 SRAPLSPHNYSTTQGYSTSSRGLYGDKKPL 659 >AY661745-1|AAT74544.1| 681|Caenorhabditis elegans CDC-14 phosphatase isoform C protein. Length = 681 Score = 28.7 bits (61), Expect = 5.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 732 AQKPICSHNIQTTSAHYVKCTGMHGNAKPL 643 ++ P+ HN TT + G++G+ KPL Sbjct: 630 SRAPLSPHNYSTTQGYSTSSRGLYGDKKPL 659 >AY661744-1|AAT74543.1| 1063|Caenorhabditis elegans CDC-14 phosphatase isoform B protein. Length = 1063 Score = 28.7 bits (61), Expect = 5.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 732 AQKPICSHNIQTTSAHYVKCTGMHGNAKPL 643 ++ P+ HN TT + G++G+ KPL Sbjct: 630 SRAPLSPHNYSTTQGYSTSSRGLYGDKKPL 659 >AF000363-1|AAB94407.1| 681|Caenorhabditis elegans protein phosphatase CDC14 protein. Length = 681 Score = 28.7 bits (61), Expect = 5.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 732 AQKPICSHNIQTTSAHYVKCTGMHGNAKPL 643 ++ P+ HN TT + G++G+ KPL Sbjct: 630 SRAPLSPHNYSTTQGYSTSSRGLYGDKKPL 659 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,776,883 Number of Sequences: 27780 Number of extensions: 376891 Number of successful extensions: 851 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1914239236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -