BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0147 (789 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60010.1 68418.m07525 ferric reductase-like transmembrane com... 31 1.2 >At5g60010.1 68418.m07525 ferric reductase-like transmembrane component family protein similar to respiratory burst oxidase protein D RbohD from Arabidopsis thaliana, EMBL:AF055357 [gi:3242789], respiratory burst oxidase homolog from Solanum tuberosum [GI:16549089]; contains Pfam profile PF01794 Ferric reductase like transmembrane component Length = 839 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +2 Query: 71 IIPLDNSINRILMNTYIIICSVVIHIYFNVYICNYISVQICMY 199 ++P D++IN + Y+I ++H +++ CNY + C Y Sbjct: 388 VVPFDDNINFHKVIAYMIAFQALLHTALHIF-CNYPRLSSCSY 429 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,130,354 Number of Sequences: 28952 Number of extensions: 321521 Number of successful extensions: 607 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -