Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0147
         (789 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g60010.1 68418.m07525 ferric reductase-like transmembrane com...    31   1.2  

>At5g60010.1 68418.m07525 ferric reductase-like transmembrane
           component family protein similar to respiratory burst
           oxidase protein D RbohD from Arabidopsis thaliana,
           EMBL:AF055357 [gi:3242789], respiratory burst oxidase
           homolog from Solanum tuberosum [GI:16549089]; contains
           Pfam profile PF01794 Ferric reductase like transmembrane
           component
          Length = 839

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 12/43 (27%), Positives = 24/43 (55%)
 Frame = +2

Query: 71  IIPLDNSINRILMNTYIIICSVVIHIYFNVYICNYISVQICMY 199
           ++P D++IN   +  Y+I    ++H   +++ CNY  +  C Y
Sbjct: 388 VVPFDDNINFHKVIAYMIAFQALLHTALHIF-CNYPRLSSCSY 429


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,130,354
Number of Sequences: 28952
Number of extensions: 321521
Number of successful extensions: 607
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 603
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 607
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1775300800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)