BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0146 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like pepti... 25 2.4 AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like pepti... 24 4.1 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 7.2 >AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 25.0 bits (52), Expect = 2.4 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +1 Query: 16 EVIPLPWEVNREHLWSTYFIRKISTRLRDSNTSVSLD 126 +++P PW ++RE ++ F+R T R S S++ + Sbjct: 95 QLVPYPWAIDREVAYA--FLRTRRTGKRRSGGSITAE 129 >AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 24.2 bits (50), Expect = 4.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 19 VIPLPWEVNREHLWSTYFIRKISTRLRDSNTSVSLD 126 ++P PW ++RE ++ F+R T R S S++ + Sbjct: 96 LVPYPWAIDREVAYA--FLRTRRTGKRRSGGSITAE 129 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.4 bits (48), Expect = 7.2 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +1 Query: 40 VNREHLWSTYFI 75 VN +H+W+T+F+ Sbjct: 549 VNNKHVWNTWFV 560 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 705,086 Number of Sequences: 2352 Number of extensions: 13317 Number of successful extensions: 54 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -