BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0145 (378 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 25 0.70 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 25 0.92 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 2.1 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 4.9 AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against p... 22 8.6 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 25.4 bits (53), Expect = 0.70 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +1 Query: 85 EVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESARE 213 E+K ++ Q+ S G G G P AAG VG S + Sbjct: 308 EIKHSSLYQQTSRQHGTGGQGSSVGGAPTGAAAGSVGTASGEQ 350 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 25.0 bits (52), Expect = 0.92 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQELG 336 ++ GP GTGK+AI I +G Sbjct: 34 IILGPNGTGKSAIVAGIVLGMG 55 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.8 bits (49), Expect = 2.1 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 73 MKIEEVKSTAKTQRISAHSHIKGLG-LDENGVPIQMAAGLVGQESARE 213 ++ E+ + ++ ++ IK G LD VPI+ AAGL E A + Sbjct: 257 VEYREMNNVQRSDFMNLLLQIKNTGSLDGGDVPIKGAAGLTMNELAAQ 304 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.6 bits (46), Expect = 4.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 151 DENGVPIQMAAGLVGQESAREA 216 D++ VP+ G G+E+ R+A Sbjct: 706 DDSDVPLDFTVGSQGKEAERDA 727 >AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against programmed cell death protein. Length = 112 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 60 FTLLNSRRYFVFCCLV 13 + LL FV+CCLV Sbjct: 32 YILLTGIMQFVYCCLV 47 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.134 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 399,902 Number of Sequences: 2352 Number of extensions: 7948 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 28646721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -