BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0145 (378 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g22330.1 68418.m02605 TATA box-binding protein-interacting pr... 161 1e-40 At5g67630.1 68418.m08527 DNA helicase, putative similar to RuvB-... 113 5e-26 At3g49830.1 68416.m05448 DNA helicase-related similar to DNA hel... 107 3e-24 At2g26140.1 68415.m03137 FtsH protease, putative contains simila... 43 6e-05 At5g15250.1 68418.m01786 FtsH protease, putative similar to FtsH... 42 1e-04 At1g06430.1 68414.m00680 FtsH protease, putative similar to zinc... 42 1e-04 At2g30950.1 68415.m03775 FtsH protease (VAR2) identical to zinc ... 42 2e-04 At4g23940.1 68417.m03443 FtsH protease, putative contains simila... 40 4e-04 At3g02450.1 68416.m00232 cell division protein ftsH, putative si... 40 4e-04 At1g64110.2 68414.m07264 AAA-type ATPase family protein contains... 39 0.001 At1g64110.1 68414.m07263 AAA-type ATPase family protein contains... 39 0.001 At4g28000.1 68417.m04016 AAA-type ATPase family protein contains... 38 0.002 At2g29080.1 68415.m03535 FtsH protease, putative similar to AAA-... 38 0.002 At1g79560.1 68414.m09275 FtsH protease, putative contains simila... 38 0.002 At1g03000.1 68414.m00271 AAA-type ATPase family protein contains... 38 0.002 At5g64580.1 68418.m08116 AAA-type ATPase family protein similar ... 38 0.003 At5g53170.1 68418.m06610 FtsH protease, putative similar to ATP-... 38 0.003 At5g42270.1 68418.m05145 FtsH protease, putative similar to FtsH... 38 0.003 At1g50250.1 68414.m05634 cell division protein ftsH homolog 1, c... 38 0.003 At4g27680.1 68417.m03980 MSP1 protein, putative / intramitochond... 37 0.004 At1g80350.1 68414.m09406 katanin 1 (KTN1) identical to katanin 1... 37 0.004 At1g59870.1 68414.m06745 ABC transporter family protein similar ... 37 0.004 At4g24710.1 68417.m03536 AAA-type ATPase family protein similar ... 37 0.005 At3g47060.1 68416.m05110 FtsH protease, putative contains simila... 37 0.005 At5g03340.1 68418.m00286 cell division cycle protein 48, putativ... 36 0.007 At4g02480.1 68417.m00335 AAA-type ATPase family protein contains... 36 0.007 At3g53230.1 68416.m05865 cell division cycle protein 48, putativ... 36 0.007 At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A)... 36 0.007 At2g45500.1 68415.m05659 AAA-type ATPase family protein similar ... 36 0.007 At2g03670.1 68415.m00326 AAA-type ATPase family protein contains... 36 0.007 At1g15210.1 68414.m01818 ABC transporter family protein Similar ... 36 0.007 At1g02890.1 68414.m00256 AAA-type ATPase family protein contains... 36 0.007 At5g58290.1 68418.m07297 26S proteasome AAA-ATPase subunit (RPT3... 36 0.009 At4g04180.1 68417.m00593 AAA-type ATPase family protein contains... 36 0.009 At3g27120.1 68416.m03393 spastin ATPase, putative similar to SWI... 36 0.009 At3g19740.1 68416.m02499 AAA-type ATPase family protein contains... 36 0.009 At2g34560.2 68415.m04246 katanin, putative similar to katanin p6... 36 0.009 At2g34560.1 68415.m04245 katanin, putative similar to katanin p6... 36 0.009 At1g50140.1 68414.m05623 AAA-type ATPase family protein contains... 36 0.009 At1g24290.1 68414.m03065 AAA-type ATPase family protein similar ... 36 0.009 At1g05910.1 68414.m00620 cell division cycle protein 48-related ... 36 0.009 At5g53540.1 68418.m06653 MSP1 protein, putative / intramitochond... 36 0.012 At5g03940.1 68418.m00374 signal recognition particle 54 kDa prot... 36 0.012 At2g27600.1 68415.m03346 AAA-type ATPase family protein / vacuol... 36 0.012 At2g18330.1 68415.m02136 AAA-type ATPase family protein contains... 36 0.012 At1g63160.1 68414.m07138 replication factor C 40 kDa, putative s... 36 0.012 At1g07510.1 68414.m00804 FtsH protease, putative similar to AAA-... 36 0.012 At5g20000.1 68418.m02380 26S proteasome AAA-ATPase subunit, puta... 35 0.016 At5g19990.1 68418.m02379 26S proteasome AAA-ATPase subunit (RPT6a) 35 0.016 At4g24860.1 68417.m03559 AAA-type ATPase family protein contains... 35 0.016 At3g01610.1 68416.m00092 AAA-type ATPase family protein contains... 35 0.016 At2g26910.1 68415.m03228 ABC transporter family protein similar ... 35 0.016 At1g77470.1 68414.m09021 replication factor C 36 kDA, putative s... 35 0.016 At5g17730.1 68418.m02079 AAA-type ATPase family protein contains... 35 0.021 At1g21690.2 68414.m02715 replication factor C 37 kDa, putative S... 35 0.021 At1g21690.1 68414.m02714 replication factor C 37 kDa, putative S... 35 0.021 At5g47040.1 68418.m05797 Lon protease homolog 1, mitochondrial (... 34 0.027 At3g05530.1 68416.m00606 26S proteasome AAA-ATPase subunit (RPT5... 34 0.027 At4g36580.1 68417.m05193 AAA-type ATPase family protein contains... 34 0.036 At4g04910.1 68417.m00714 AAA-type ATPase family protein similar ... 34 0.036 At3g50940.1 68416.m05577 AAA-type ATPase family protein contains... 34 0.036 At3g16290.1 68416.m02056 FtsH protease, putative contains simila... 34 0.036 At3g04340.1 68416.m00459 FtsH protease family protein similar to... 34 0.036 At1g09100.1 68414.m01016 26S protease regulatory subunit 6A, put... 34 0.036 At5g58870.1 68418.m07376 FtsH protease, putative contains simila... 33 0.048 At5g43010.1 68418.m05245 26S proteasome AAA-ATPase subunit (RPT4... 33 0.048 At4g30250.1 68417.m04301 AAA-type ATPase family protein contains... 33 0.048 At3g03060.1 68416.m00302 AAA-type ATPase family protein contains... 33 0.048 At1g45000.1 68414.m05158 26S proteasome regulatory complex subun... 33 0.048 At5g57480.1 68418.m07183 AAA-type ATPase family protein contains... 33 0.063 At3g56690.1 68416.m06306 calmodulin-binding protein identical to... 33 0.063 At1g73170.1 68414.m08466 expressed protein 33 0.063 At3g50930.1 68416.m05576 AAA-type ATPase family protein contains... 33 0.083 At5g26860.1 68418.m03204 Lon protease homolog 2, mitochondrial a... 32 0.11 At5g17760.2 68418.m02083 AAA-type ATPase family protein contains... 32 0.11 At5g17760.1 68418.m02082 AAA-type ATPase family protein contains... 32 0.11 At5g17740.1 68418.m02080 AAA-type ATPase family protein h-bcs1, ... 32 0.11 At1g62130.1 68414.m07010 AAA-type ATPase family protein contains... 32 0.11 At1g43910.1 68414.m05066 AAA-type ATPase family protein contains... 32 0.11 At4g05380.1 68417.m00820 AAA-type ATPase family protein contains... 32 0.15 At3g05780.1 68416.m00649 Lon protease, putative similar to Lon p... 32 0.15 At2g18193.1 68415.m02117 AAA-type ATPase family protein contains... 32 0.15 At2g18190.1 68415.m02116 AAA-type ATPase family protein contains... 32 0.15 At1g53750.1 68414.m06115 26S proteasome AAA-ATPase subunit (RPT1... 32 0.15 At5g22010.1 68418.m02561 AAA-type ATPase family protein / BRCT d... 31 0.19 At5g16930.1 68418.m01984 AAA-type ATPase family protein contains... 31 0.19 At4g29040.1 68417.m04153 26S proteasome AAA-ATPase subunit (RPT2... 31 0.19 At4g25835.1 68417.m03716 AAA-type ATPase family protein contains... 31 0.19 At3g28600.1 68416.m03570 AAA-type ATPase family protein contains... 31 0.19 At2g20140.1 68415.m02353 26S protease regulatory complex subunit... 31 0.19 At1g53780.1 68414.m06120 26S proteasome AAA-ATPase subunit, puta... 31 0.19 At1g15520.1 68414.m01867 ABC transporter family protein similar ... 31 0.19 At5g17750.1 68418.m02081 AAA-type ATPase family protein contains... 31 0.25 At4g15236.1 68417.m02335 ABC transporter family protein similar ... 31 0.25 At3g28510.1 68416.m03561 AAA-type ATPase family protein contains... 31 0.25 At2g29940.1 68415.m03642 ABC transporter family protein similar ... 31 0.25 At5g47010.1 68418.m05794 RNA helicase, putative similar to type ... 31 0.34 At3g28520.1 68416.m03562 AAA-type ATPase family protein contains... 31 0.34 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 31 0.34 At5g40010.1 68418.m04852 AAA-type ATPase family protein contains... 30 0.44 At3g28610.1 68416.m03571 AAA-type ATPase family protein contains... 30 0.44 At3g28580.1 68416.m03568 AAA-type ATPase family protein contains... 30 0.44 At3g28570.1 68416.m03567 AAA-type ATPase family protein contains... 30 0.44 At3g16340.1 68416.m02066 ABC transporter family protein similar ... 30 0.44 At1g66950.1 68414.m07612 ABC transporter family protein similar ... 30 0.44 At5g40000.1 68418.m04851 AAA-type ATPase family protein BCS1 nuc... 30 0.59 At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR... 30 0.59 At3g45450.1 68416.m04908 Clp amino terminal domain-containing pr... 30 0.59 At4g19500.1 68417.m02868 disease resistance protein (TIR-NBS-LRR... 29 0.78 At3g28540.1 68416.m03564 AAA-type ATPase family protein contains... 29 0.78 At5g66005.2 68418.m08311 Expressed protein 29 1.0 At3g44400.1 68416.m04770 disease resistance protein (TIR-NBS-LRR... 29 1.0 At2g03270.1 68415.m00280 DNA-binding protein, putative similar t... 29 1.0 At1g77620.1 68414.m09037 expressed protein 29 1.0 At5g66910.1 68418.m08434 disease resistance protein (CC-NBS-LRR ... 29 1.4 At5g41540.1 68418.m05048 disease resistance protein (TIR-NBS-LRR... 29 1.4 At5g37160.1 68418.m04461 tRNA-splicing endonuclease positive eff... 29 1.4 At4g15233.1 68417.m02334 ABC transporter family protein similar ... 29 1.4 At4g14670.1 68417.m02255 heat shock protein 101, putative / HSP1... 29 1.4 At5g50920.1 68418.m06315 ATP-dependent Clp protease ATP-binding ... 28 1.8 At5g37140.1 68418.m04458 tRNA-splicing endonuclease positive eff... 28 1.8 At5g20040.2 68418.m02385 tRNA isopentenyltransferase 9 / IPP tra... 28 1.8 At5g20040.1 68418.m02384 tRNA isopentenyltransferase 9 / IPP tra... 28 1.8 At5g18370.1 68418.m02161 disease resistance protein (TIR-NBS-LRR... 28 1.8 At5g18350.1 68418.m02159 disease resistance protein (TIR-NBS-LRR... 28 1.8 At5g08470.1 68418.m00999 peroxisome biogenesis protein (PEX1) id... 28 1.8 At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding ... 28 1.8 At3g24530.1 68416.m03080 AAA-type ATPase family protein / ankyri... 28 1.8 At3g05790.1 68416.m00650 Lon protease, putative similar to Lon p... 28 1.8 At2g36380.1 68415.m04464 ABC transporter family protein related ... 28 1.8 At1g35750.1 68414.m04445 pumilio/Puf RNA-binding domain-containi... 28 1.8 At5g60340.1 68418.m07564 maoC-like dehydratase domain-containing... 28 2.4 At5g51070.1 68418.m06330 ATP-dependent Clp protease ATP-binding ... 28 2.4 At4g15570.1 68417.m02379 tRNA-splicing endonuclease positive eff... 28 2.4 At4g15215.1 68417.m02332 ABC transporter family protein similar ... 28 2.4 At2g46620.1 68415.m05815 AAA-type ATPase family protein contains... 28 2.4 At2g37280.1 68415.m04573 ABC transporter family protein similar ... 28 2.4 At2g34470.1 68415.m04231 urease accessory protein (UREG) identic... 28 2.4 At2g07710.1 68415.m00998 hypothetical protein 28 2.4 At1g74310.1 68414.m08605 heat shock protein 101 (HSP101) identic... 28 2.4 At1g63880.1 68414.m07234 disease resistance protein (TIR-NBS-LRR... 28 2.4 At1g16800.1 68414.m02018 tRNA-splicing endonuclease positive eff... 28 2.4 At1g03030.1 68414.m00275 phosphoribulokinase/uridine kinase fami... 28 2.4 At4g26090.1 68417.m03756 disease resistance protein RPS2 (CC-NBS... 27 3.1 At4g16990.3 68417.m02563 disease resistance protein (TIR-NBS cla... 27 3.1 At4g16990.2 68417.m02562 disease resistance protein (TIR-NBS cla... 27 3.1 At4g16990.1 68417.m02561 disease resistance protein (TIR-NBS cla... 27 3.1 At4g14700.1 68417.m02259 replication control protein, putative s... 27 3.1 At4g12620.1 68417.m01988 replication control protein, putative s... 27 3.1 At3g15120.1 68416.m01913 AAA-type ATPase family protein contains... 27 3.1 At2g25140.1 68415.m03007 heat shock protein 100, putative / HSP1... 27 3.1 At1g04730.1 68414.m00469 AAA-type ATPase family protein contains... 27 3.1 At5g43140.1 68418.m05266 peroxisomal membrane 22 kDa family prot... 27 4.1 At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP1... 27 4.1 At4g15230.1 68417.m02333 ABC transporter family protein similar ... 27 4.1 At3g53480.1 68416.m05904 ABC transporter family protein PDR5-lik... 27 4.1 At3g29800.1 68416.m03792 AAA-type ATPase family contains Pfam pr... 27 4.1 At2g36250.2 68415.m04450 chloroplast division protein FtsZ (FtsZ... 27 4.1 At2g36250.1 68415.m04449 chloroplast division protein FtsZ (FtsZ... 27 4.1 At2g14080.1 68415.m01566 disease resistance protein (TIR-NBS-LRR... 27 4.1 At1g63870.1 68414.m07233 disease resistance protein (TIR-NBS-LRR... 27 4.1 At5g66900.1 68418.m08433 disease resistance protein (CC-NBS-LRR ... 27 5.5 At5g53350.1 68418.m06630 ATP-dependent Clp protease ATP-binding ... 27 5.5 At5g49840.1 68418.m06172 ATP-dependent Clp protease ATP-binding ... 27 5.5 At5g11250.1 68418.m01314 disease resistance protein (TIR-NBS-LRR... 27 5.5 At3g30842.1 68416.m03968 ABC transporter protein, putative simil... 27 5.5 At2g38770.1 68415.m04760 expressed protein 27 5.5 At1g55700.1 68414.m06378 DC1 domain-containing protein contains ... 27 5.5 At1g33290.2 68414.m04118 sporulation protein-related isoform con... 27 5.5 At1g33290.1 68414.m04117 sporulation protein-related isoform con... 27 5.5 At5g64150.1 68418.m08055 methylase family protein contains TIGRf... 26 7.2 At5g45260.1 68418.m05555 disease resistance protein (TIR-NBS-LRR... 26 7.2 At5g35970.1 68418.m04332 DNA-binding protein, putative similar t... 26 7.2 At5g15920.1 68418.m01862 structural maintenance of chromosomes (... 26 7.2 At4g31780.2 68417.m04510 1,2-diacylglycerol 3-beta-galactosyltra... 26 7.2 At4g31780.1 68417.m04509 1,2-diacylglycerol 3-beta-galactosyltra... 26 7.2 At4g14770.1 68417.m02272 tesmin/TSO1-like CXC domain-containing ... 26 7.2 At5g40910.1 68418.m04967 disease resistance protein (TIR-NBS-LRR... 26 9.6 At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99... 26 9.6 At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99... 26 9.6 At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99... 26 9.6 At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99... 26 9.6 At4g14790.1 68417.m02274 ATP-dependent RNA helicase, mitochondri... 26 9.6 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 26 9.6 At2g19490.1 68415.m02278 recA family protein contains Pfam profi... 26 9.6 >At5g22330.1 68418.m02605 TATA box-binding protein-interacting protein-related similar to TATA box-binding protein-interacting protein SP:O35753 from [ Mus musculus] Length = 458 Score = 161 bits (392), Expect = 1e-40 Identities = 75/102 (73%), Positives = 90/102 (88%) Frame = +1 Query: 73 MKIEEVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKK 252 +KIEE++STAK QRI+ H+HIKGLGL+ G+PI++AAG VGQ AREAAG+VVDMI+ KK Sbjct: 4 VKIEEIQSTAKKQRIATHTHIKGLGLEPTGIPIKLAAGFVGQLEAREAAGLVVDMIKQKK 63 Query: 253 MARRALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEVY 378 MA +ALLLAGPPGTGKTA+AL I+QELG+K PFCPM GSEVY Sbjct: 64 MAGKALLLAGPPGTGKTALALGISQELGSKVPFCPMVGSEVY 105 >At5g67630.1 68418.m08527 DNA helicase, putative similar to RuvB-like DNA helicase reptin [Danio rerio] GI:27733814, reptin [Drosophila melanogaster] GI:7243682 Length = 469 Score = 113 bits (271), Expect = 5e-26 Identities = 51/102 (50%), Positives = 74/102 (72%) Frame = +1 Query: 73 MKIEEVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKK 252 +K+ E + + +RI AHSHI+GLGLD P ++ G+VGQ AR+AAG+++ MIR K Sbjct: 4 LKLSESRDLTRVERIGAHSHIRGLGLDSALEPRAVSEGMVGQVKARKAAGVILQMIREGK 63 Query: 253 MARRALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEVY 378 +A RA+L+AG PGTGKTAIA+ +A+ LG + PF + GSE++ Sbjct: 64 IAGRAILIAGQPGTGKTAIAMGMAKSLGLETPFAMIAGSEIF 105 >At3g49830.1 68416.m05448 DNA helicase-related similar to DNA helicase GI:4521249 from [Mus musculus] Length = 473 Score = 107 bits (256), Expect = 3e-24 Identities = 48/102 (47%), Positives = 73/102 (71%) Frame = +1 Query: 73 MKIEEVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKK 252 +++ E + + +RI AHSHI+GLGLD P ++ G+VGQ AR+AAG+ +++IR K Sbjct: 4 LRLSETRDLTRIERIGAHSHIRGLGLDSVLEPRAVSEGMVGQIKARKAAGVTLELIRDGK 63 Query: 253 MARRALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEVY 378 ++ RA+L+AG PGTGK AIA+ IA+ LG + PF + GSE++ Sbjct: 64 ISGRAILIAGQPGTGKIAIAMGIAKSLGQETPFTMIAGSEIF 105 >At2g26140.1 68415.m03137 FtsH protease, putative contains similarity to YME1 GI:295582, a member of the ftsH-SEC18-PAS1-CDC48 family of putative ATPase-encoding genes from [Saccharomyces cerevisiae] Length = 717 Score = 43.2 bits (97), Expect = 6e-05 Identities = 34/90 (37%), Positives = 43/90 (47%), Gaps = 11/90 (12%) Frame = +1 Query: 136 KGLGLDENGVPIQMAA----GLVGQESAREAAGIVVDMIRSKKMARR-------ALLLAG 282 KGLGL E P ++ + G + A+ +V +R K R +LL G Sbjct: 208 KGLGLHEEVQPSMDSSTKFSDVKGVDEAKAELEEIVHYLRDPKRFTRLGGKLPKGVLLVG 267 Query: 283 PPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 PPGTGKT +A AIA E G PF GSE Sbjct: 268 PPGTGKTMLARAIAGEAGV--PFFSCSGSE 295 >At5g15250.1 68418.m01786 FtsH protease, putative similar to FtsH-like protein Pftf precursor GI:4325041 from [Nicotiana tabacum] Length = 687 Score = 42.3 bits (95), Expect = 1e-04 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 + +LL GPPGTGKT +A AIA E G PF + GSE Sbjct: 257 KGVLLTGPPGTGKTLLAKAIAGEAGV--PFFSLSGSE 291 >At1g06430.1 68414.m00680 FtsH protease, putative similar to zinc dependent protease GI:7650138 from [Arabidopsis thaliana] Length = 685 Score = 41.9 bits (94), Expect = 1e-04 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 + +LL GPPGTGKT +A AIA E G PF + GSE Sbjct: 254 KGVLLVGPPGTGKTLLAKAIAGEAGV--PFFSISGSE 288 >At2g30950.1 68415.m03775 FtsH protease (VAR2) identical to zinc dependent protease VAR2 GI:7650138 from [Arabidopsis thaliana] Length = 695 Score = 41.5 bits (93), Expect = 2e-04 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 + +LL GPPGTGKT +A AIA E G PF + GSE Sbjct: 261 KGVLLIGPPGTGKTLLAKAIAGEAGV--PFFSISGSE 295 >At4g23940.1 68417.m03443 FtsH protease, putative contains similarity to zinc dependent protease GI:7650138 from [Arabidopsis thaliana] Length = 946 Score = 40.3 bits (90), Expect = 4e-04 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 +LL GPPG GKT +A AIA E G PF M GSE Sbjct: 466 VLLEGPPGCGKTLVAKAIAGEAGV--PFYQMAGSE 498 >At3g02450.1 68416.m00232 cell division protein ftsH, putative similar to SWISS-PROT:P46469 cell division protein ftsH homolog [Lactococcus lactis]; contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 622 Score = 40.3 bits (90), Expect = 4e-04 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 R +LL GPPGTGKT +A A+A E G PF + SE Sbjct: 368 RGVLLVGPPGTGKTLLARAVAGEAGV--PFFSVSASE 402 >At1g64110.2 68414.m07264 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 829 Score = 38.7 bits (86), Expect = 0.001 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG 336 R +LL GPPGTGKT +A AIA+E G Sbjct: 556 RGILLFGPPGTGKTMLAKAIAKEAG 580 >At1g64110.1 68414.m07263 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 824 Score = 38.7 bits (86), Expect = 0.001 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG 336 R +LL GPPGTGKT +A AIA+E G Sbjct: 551 RGILLFGPPGTGKTMLAKAIAKEAG 575 >At4g28000.1 68417.m04016 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 726 Score = 37.9 bits (84), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG 336 R +LL GPPGTGKT +A AIA E G Sbjct: 449 RGILLFGPPGTGKTMMAKAIANEAG 473 >At2g29080.1 68415.m03535 FtsH protease, putative similar to AAA-metalloprotease FtsH [Pisum sativum] GI:15021761; contains Pfam profiles PF01434: Peptidase family M41, PF00004: ATPase AAA family Length = 809 Score = 37.9 bits (84), Expect = 0.002 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 + LL GPPGTGKT +A A A E G PF + GS+ Sbjct: 356 KGALLVGPPGTGKTLLAKATAGESGV--PFLSISGSD 390 >At1g79560.1 68414.m09275 FtsH protease, putative contains similarity to chloroplast FtsH protease GI:5804782 from [Nicotiana tabacum] Length = 1008 Score = 37.9 bits (84), Expect = 0.002 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 R +LL+GPPGTGKT A +A+E G PF G+E Sbjct: 527 RGVLLSGPPGTGKTLFARTLAKESGL--PFVFASGAE 561 >At1g03000.1 68414.m00271 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 941 Score = 37.9 bits (84), Expect = 0.002 Identities = 21/44 (47%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +1 Query: 232 DMIRSKKMARRALLLAGPPGTGKTAIALAIAQE-----LGTKGP 348 D+ S R +LL GPPGTGKT +A A+A E L KGP Sbjct: 682 DLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGP 725 >At5g64580.1 68418.m08116 AAA-type ATPase family protein similar to zinc dependent protease [Arabidopsis thaliana] GI:7650138; contains Pfam profile PF00004: ATPase AAA family Length = 855 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 + +LL GPPGTGKT +A AIA E G PF G++ Sbjct: 350 KGVLLHGPPGTGKTLLAKAIAGEAGL--PFFAANGTD 384 >At5g53170.1 68418.m06610 FtsH protease, putative similar to ATP-dependent metalloprotease FtsH1 GI:3600100 from [Mus musculus] Length = 806 Score = 37.5 bits (83), Expect = 0.003 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 + +LL G PGTGKT +A AIA E G PF GSE Sbjct: 396 KGILLTGAPGTGKTLLAKAIAGEAGV--PFFYRAGSE 430 >At5g42270.1 68418.m05145 FtsH protease, putative similar to FtsH protease GI:13183728 from [Medicago sativa] Length = 704 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 + LL GPPGTGKT +A A+A E G PF SE Sbjct: 284 KGCLLVGPPGTGKTLLARAVAGEAGV--PFFSCAASE 318 >At1g50250.1 68414.m05634 cell division protein ftsH homolog 1, chloroplast (FTSH1) (FTSH) identical to SP:Q39102 Cell division protein ftsH homolog 1, chloroplast precursor (EC 3.4.24.-) [Arabidopsis thaliana] Length = 716 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 + LL GPPGTGKT +A A+A E G PF SE Sbjct: 296 KGCLLVGPPGTGKTLLARAVAGEAGV--PFFSCAASE 330 >At4g27680.1 68417.m03980 MSP1 protein, putative / intramitochondrial sorting protein, putative similar to Swiss-Prot:P28737 MSP1 protein (TAT-binding homolog 4) [Saccharomyces cerevisiae]; contains Pfam domain, PF00004: ATPase, AAA family Length = 398 Score = 37.1 bits (82), Expect = 0.004 Identities = 16/26 (61%), Positives = 21/26 (80%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQELG 336 ++ +LL GPPGTGKT +A AIA+E G Sbjct: 119 QKGVLLYGPPGTGKTMLAKAIAKESG 144 >At1g80350.1 68414.m09406 katanin 1 (KTN1) identical to katanin 1 (KTN1) [Arabidopsis thaliana] GI:14133602 Length = 523 Score = 37.1 bits (82), Expect = 0.004 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGT 339 + +L+ GPPGTGKT +A A+A E GT Sbjct: 273 KGVLMFGPPGTGKTLLAKAVATECGT 298 >At1g59870.1 68414.m06745 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1469 Score = 37.1 bits (82), Expect = 0.004 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +1 Query: 172 QMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 + A G++G + A++A ++ I R LL GPP +GKT + LA+A +L Sbjct: 168 ESALGMIGIQFAKKAQLTILKDISGVIKPGRMTLLLGPPSSGKTTLLLALAGKL 221 >At4g24710.1 68417.m03536 AAA-type ATPase family protein similar to HPV16 E1 protein binding protein [Homo sapiens] gi|2232019|gb|AAB64095; contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 467 Score = 36.7 bits (81), Expect = 0.005 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTK 342 R +LL GPPGTGKT++ A+AQ+L + Sbjct: 203 RIILLHGPPGTGKTSLCKALAQKLSIR 229 >At3g47060.1 68416.m05110 FtsH protease, putative contains similarity to FtsH protease GI:13183728 from [Medicago sativa] Length = 802 Score = 36.7 bits (81), Expect = 0.005 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 7/71 (9%) Frame = +1 Query: 181 AGLVGQESAREAAGIVVDMIRS-KKMAR------RALLLAGPPGTGKTAIALAIAQELGT 339 A + G + A+E +V+ +R+ +K R R +LL G PGTGKT +A A+A E Sbjct: 325 ADVAGVDEAKEELEEIVEFLRNPEKYVRLGARPPRGVLLVGLPGTGKTLLAKAVAGE--A 382 Query: 340 KGPFCPMGGSE 372 + PF SE Sbjct: 383 EVPFISCSASE 393 >At5g03340.1 68418.m00286 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; supporting cDNA gi|26449351|dbj|AK117125.1| Length = 810 Score = 36.3 bits (80), Expect = 0.007 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 + +LL GPPG+GKT IA A+A E G FC + G E+ Sbjct: 242 KGILLYGPPGSGKTLIARAVANETGAFF-FC-INGPEI 277 Score = 31.1 bits (67), Expect = 0.25 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQE-----LGTKGP 348 + +L GPPG GKT +A AIA E + KGP Sbjct: 515 KGVLFYGPPGCGKTLLAKAIANECQANFISVKGP 548 >At4g02480.1 68417.m00335 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family; similar to Spastin (Swiss-Prot:Q9UBP0) [Homo sapiens] and Spastin (Fragment) (Swiss-Prot:Q9QYY8) [Mus musculus]; similar to mitochondrial sorting protein 1 (MSP1) protein (TAT-binding homolog 4) (Swiss-Prot:P28737) [Saccharomyces cerevisiae] Length = 1265 Score = 36.3 bits (80), Expect = 0.007 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG 336 + +LL GPPGTGKT +A A+A E G Sbjct: 999 KGILLFGPPGTGKTMLAKAVATEAG 1023 >At3g53230.1 68416.m05865 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain Length = 815 Score = 36.3 bits (80), Expect = 0.007 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 + +LL GPPG+GKT IA A+A E G FC + G E+ Sbjct: 243 KGILLYGPPGSGKTLIARAVANETGAFF-FC-INGPEI 278 Score = 30.7 bits (66), Expect = 0.34 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQE 330 + +L GPPG GKT +A AIA E Sbjct: 516 KGVLFYGPPGCGKTLLAKAIANE 538 >At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A) (CDC48) identical to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana} Length = 809 Score = 36.3 bits (80), Expect = 0.007 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 + +LL GPPG+GKT IA A+A E G FC + G E+ Sbjct: 242 KGILLYGPPGSGKTLIARAVANETGAFF-FC-INGPEI 277 Score = 31.1 bits (67), Expect = 0.25 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQE-----LGTKGP 348 + +L GPPG GKT +A AIA E + KGP Sbjct: 515 KGVLFYGPPGCGKTLLAKAIANECQANFISVKGP 548 >At2g45500.1 68415.m05659 AAA-type ATPase family protein similar to SP|Q9QYY8 Spastin (Fragment) {Mus musculus}; contains Pfam profiles PF00004: ATPase AAA family, PF04212: MIT domain Length = 487 Score = 36.3 bits (80), Expect = 0.007 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 232 DMIRSKKMARRALLLAGPPGTGKTAIALAIAQE 330 D+ + R LLL GPPG GKT +A A+A E Sbjct: 240 DLFTGLRRPARGLLLFGPPGNGKTMLAKAVASE 272 >At2g03670.1 68415.m00326 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 603 Score = 36.3 bits (80), Expect = 0.007 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQE 330 R LLL GPPGTGKT++ A+ QE Sbjct: 57 RGLLLYGPPGTGKTSLVRAVVQE 79 >At1g15210.1 68414.m01818 ABC transporter family protein Similar to gb|Z70524 GI:1514643 PDR5-like ABC transporter from Spirodela polyrrhiza and is a member of the PF|00005 ABC transporter family. ESTs gb|N97039 and gb|T43169 come from this gene Length = 1442 Score = 36.3 bits (80), Expect = 0.007 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +1 Query: 172 QMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 + A G++G A++A ++ + R LL GPP +GKT + LA+A +L Sbjct: 166 EAALGMIGIRLAKKAQLTILKDVSGIVKPSRMTLLLGPPSSGKTTLLLALAGKL 219 >At1g02890.1 68414.m00256 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family; similar to mitochondrial sorting protein 1 (MSP1) (TAT-binding homolog 4) (Swiss-Prot:P28737) [Saccharomyces cerevisiae] Length = 1252 Score = 36.3 bits (80), Expect = 0.007 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG 336 + +LL GPPGTGKT +A A+A E G Sbjct: 986 KGILLFGPPGTGKTMLAKAVATEAG 1010 >At5g58290.1 68418.m07297 26S proteasome AAA-ATPase subunit (RPT3) identical to 26S proteasome AAA-ATPase subunit RPT3 GI:6652882 from [Arabidopsis thaliana] Length = 408 Score = 35.9 bits (79), Expect = 0.009 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 R +LL GPPGTGKT +A A+A T F + GSE Sbjct: 190 RGVLLYGPPGTGKTMLAKAVANH--TTAAFIRVVGSE 224 >At4g04180.1 68417.m00593 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 609 Score = 35.9 bits (79), Expect = 0.009 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPM 360 RA+L GPPGTGKT+ A IA + G + P+ Sbjct: 362 RAVLFEGPPGTGKTSCARVIANQAGIPLLYVPL 394 >At3g27120.1 68416.m03393 spastin ATPase, putative similar to SWISS-PROT:Q9QYY8 spastin (Fragment) [Mus musculus]; contains Pfam domain, PF00004: ATPase, AAA family Length = 287 Score = 35.9 bits (79), Expect = 0.009 Identities = 17/33 (51%), Positives = 21/33 (63%) Frame = +1 Query: 232 DMIRSKKMARRALLLAGPPGTGKTAIALAIAQE 330 D+ + + + LLL GPPGTGKT I AIA E Sbjct: 34 DIFKGCRSPGKGLLLFGPPGTGKTMIGKAIAGE 66 >At3g19740.1 68416.m02499 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 439 Score = 35.9 bits (79), Expect = 0.009 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG 336 + +LL GPPGTGKT +A A+A E G Sbjct: 186 KGILLFGPPGTGKTLLAKALATEAG 210 >At2g34560.2 68415.m04246 katanin, putative similar to katanin p60 subunit [Strongylocentrotus purpuratus] GI:3098603; contains Pfam profile PF00004: ATPase AAA family Length = 393 Score = 35.9 bits (79), Expect = 0.009 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGT 339 + +LL GPPGTGKT +A A+A E T Sbjct: 146 KGILLFGPPGTGKTMLAKAVATECNT 171 >At2g34560.1 68415.m04245 katanin, putative similar to katanin p60 subunit [Strongylocentrotus purpuratus] GI:3098603; contains Pfam profile PF00004: ATPase AAA family Length = 384 Score = 35.9 bits (79), Expect = 0.009 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGT 339 + +LL GPPGTGKT +A A+A E T Sbjct: 137 KGILLFGPPGTGKTMLAKAVATECNT 162 >At1g50140.1 68414.m05623 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 640 Score = 35.9 bits (79), Expect = 0.009 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG 336 + +LL GPPGTGKT +A A+A E G Sbjct: 387 KGILLFGPPGTGKTLLAKALATEAG 411 >At1g24290.1 68414.m03065 AAA-type ATPase family protein similar to Werner helicase interacting protein [Homo sapiens] GI:14349166; contains Pfam profiles PF00004: ATPase family associated with various cellular activities (AAA), PF00627: UBA/TS-N domain; contains ATP/GTP-binding site motif A (P-loop) Length = 525 Score = 35.9 bits (79), Expect = 0.009 Identities = 21/73 (28%), Positives = 40/73 (54%) Frame = +1 Query: 103 KTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAG 282 K ++S+ SH + L E P + +VGQ+ + ++ + S ++ +++ G Sbjct: 88 KRHKLSSSSHRQHQPLSERMRP-RTLDDVVGQDHLLSPSSLLRSAVESNRLP--SIVFWG 144 Query: 283 PPGTGKTAIALAI 321 PPGTGKT+IA ++ Sbjct: 145 PPGTGKTSIAKSL 157 >At1g05910.1 68414.m00620 cell division cycle protein 48-related / CDC48-related similar to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF00439: Bromodomain Length = 1210 Score = 35.9 bits (79), Expect = 0.009 Identities = 20/41 (48%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAI---AQELGTKGPFCPMGGSEV 375 R +LL GPPGTGKT IA A+ A + G K F G++V Sbjct: 416 RGVLLCGPPGTGKTLIARALACAASKAGQKVSFYMRKGADV 456 >At5g53540.1 68418.m06653 MSP1 protein, putative / intramitochondrial sorting protein, putative similar to Swiss-Prot:P28737 MSP1 protein (TAT-binding homolog 4) [Saccharomyces cerevisiae]; contains Pfam domain, PF00004: ATPase, AAA family Length = 403 Score = 35.5 bits (78), Expect = 0.012 Identities = 15/24 (62%), Positives = 20/24 (83%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQE 330 ++ +LL GPPGTGKT +A AIA+E Sbjct: 122 QKGVLLYGPPGTGKTMLAKAIARE 145 >At5g03940.1 68418.m00374 signal recognition particle 54 kDa protein, chloroplast / 54 chloroplast protein / SRP54 (FFC) identical to Swiss-Prot:P37107 signal recognition particle 54 kDa protein, chloroplast precursor (SRP54) (54 chloroplast protein) (54CP) (FFC) [Arabidopsis thaliana] Length = 564 Score = 35.5 bits (78), Expect = 0.012 Identities = 23/80 (28%), Positives = 36/80 (45%) Frame = +1 Query: 139 GLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALA 318 G+G+ P Q +V E + G V ++ + K +LLAG G GKT + Sbjct: 137 GMGVIRGVKPDQQLVKIVHDELVKLMGGEVSEL-QFAKSGPTVILLAGLQGVGKTTVCAK 195 Query: 319 IAQELGTKGPFCPMGGSEVY 378 +A L +G C + +VY Sbjct: 196 LACYLKKQGKSCMLIAGDVY 215 >At2g27600.1 68415.m03346 AAA-type ATPase family protein / vacuolar sorting protein-related similar to SP|P46467 SKD1 protein (Vacuolar sorting protein 4b) {Mus musculus}; contains Pfam profiles PF00004: ATPase AAA family, PF04212: MIT domain Length = 435 Score = 35.5 bits (78), Expect = 0.012 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 4/54 (7%) Frame = +1 Query: 181 AGLVGQESAREAAGIVV----DMIRSKKMARRALLLAGPPGTGKTAIALAIAQE 330 AGL + A + A I+ K+ RA LL GPPGTGK+ +A A+A E Sbjct: 135 AGLESAKQALQEAVILPVKFPQFFTGKRRPWRAFLLYGPPGTGKSYLAKAVATE 188 >At2g18330.1 68415.m02136 AAA-type ATPase family protein contains Pfam profile: PF00004 ATPase family associated with various cellular activities (AAA) Length = 636 Score = 35.5 bits (78), Expect = 0.012 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 6/51 (11%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQELG------TKGPFCPMGGSEV 375 +S K R ++ GPPGTGKT +A IA++ G T G P+G V Sbjct: 379 KSHKAPFRNMMFYGPPGTGKTMVAREIARKSGLDYAMMTGGDVAPLGAQAV 429 >At1g63160.1 68414.m07138 replication factor C 40 kDa, putative similar to SWISS-PROT:Q9WUK4 activator 1 40 kDa subunit (Replication factor C 40 kDa subunit, A1 40 kDa subunit, RF-C 40 kDa subunit, RFC40) [Mus musculus] Length = 333 Score = 35.5 bits (78), Expect = 0.012 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQEL 333 L+L+GPPGTGKT LA+A EL Sbjct: 51 LILSGPPGTGKTTSILALAHEL 72 >At1g07510.1 68414.m00804 FtsH protease, putative similar to AAA-metalloprotease FtsH [Pisum sativum] GI:15021761; contains Pfam profiles PF01434: Peptidase family M41, PF00004: ATPase AAA family Length = 813 Score = 35.5 bits (78), Expect = 0.012 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSE 372 + LL GPPGTGKT +A A A E PF + GS+ Sbjct: 361 KGALLVGPPGTGKTLLAKATAGESAV--PFLSISGSD 395 >At5g20000.1 68418.m02380 26S proteasome AAA-ATPase subunit, putative almost identical to 26S proteasome AAA-ATPase subunit RPT6a GI:6652888 from [Arabidopsis thaliana]; almost identical to a member of conserved Sug1 CAD family AtSUG1 GI:13537115 from [Arabidopsis thaliana] Length = 419 Score = 35.1 bits (77), Expect = 0.016 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 + +LL GPPGTGKT +A A+A T F + GSE+ Sbjct: 196 KGVLLYGPPGTGKTLLARAVAHH--TDCTFIRVSGSEL 231 >At5g19990.1 68418.m02379 26S proteasome AAA-ATPase subunit (RPT6a) Length = 419 Score = 35.1 bits (77), Expect = 0.016 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 + +LL GPPGTGKT +A A+A T F + GSE+ Sbjct: 196 KGVLLYGPPGTGKTLLARAVAHH--TDCTFIRVSGSEL 231 >At4g24860.1 68417.m03559 AAA-type ATPase family protein contains Pfam profile PF00004: ATPase, AAA family Length = 1122 Score = 35.1 bits (77), Expect = 0.016 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQE 330 + +LL GPPGTGKT +A A+A+E Sbjct: 856 KGILLFGPPGTGKTMLAKAVAKE 878 >At3g01610.1 68416.m00092 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 820 Score = 35.1 bits (77), Expect = 0.016 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 +L GPPG GKT +A AIA E G PF + +EV Sbjct: 270 ILFHGPPGCGKTKLANAIANEAGV--PFYKISATEV 303 Score = 32.7 bits (71), Expect = 0.083 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 LL GPPG GKT IA A A E G F + G+E+ Sbjct: 566 LLYGPPGCGKTLIAKAAANEAGAN--FMHIKGAEL 598 >At2g26910.1 68415.m03228 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1420 Score = 35.1 bits (77), Expect = 0.016 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = +1 Query: 226 VVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELGT 339 ++D I R LL GPP +GKT + LA+A LGT Sbjct: 150 ILDGISGVIRPSRLTLLLGPPSSGKTTLLLALAGRLGT 187 >At1g77470.1 68414.m09021 replication factor C 36 kDA, putative similar to SWISS-PROT:P40937 activator 1 36 kDa subunit (Replication factor C 36 kDa subunit, A1 36 kDa subunit, RF-C 36 kDa subunit, RFC36) [Homo sapiens] Length = 369 Score = 35.1 bits (77), Expect = 0.016 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQEL 333 LLL GPPGTGKT+ LA+A++L Sbjct: 75 LLLYGPPGTGKTSTILAVARKL 96 >At5g17730.1 68418.m02079 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 470 Score = 34.7 bits (76), Expect = 0.021 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R K +R LL GPPGTGKT++ AIA L Sbjct: 239 RVGKPWKRGYLLYGPPGTGKTSLVAAIANYL 269 >At1g21690.2 68414.m02715 replication factor C 37 kDa, putative Similar to SWISS-PROT:P35249 activator 1 37 kDa subunit (Replication factor C 37 kDa subunit, A1 37 kDa subunit, RF-C 37 kDa subunit, RFC37) [Homo sapiens]; contains Pfam domain, PF00004: ATPase, AAA family Length = 327 Score = 34.7 bits (76), Expect = 0.021 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQEL 333 +L GPPGTGKT ALAIA +L Sbjct: 33 MLFYGPPGTGKTTTALAIAHQL 54 >At1g21690.1 68414.m02714 replication factor C 37 kDa, putative Similar to SWISS-PROT:P35249 activator 1 37 kDa subunit (Replication factor C 37 kDa subunit, A1 37 kDa subunit, RF-C 37 kDa subunit, RFC37) [Homo sapiens]; contains Pfam domain, PF00004: ATPase, AAA family Length = 339 Score = 34.7 bits (76), Expect = 0.021 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQEL 333 +L GPPGTGKT ALAIA +L Sbjct: 45 MLFYGPPGTGKTTTALAIAHQL 66 >At5g47040.1 68418.m05797 Lon protease homolog 1, mitochondrial (LON) identical to Lon protease homolog 1 mitochondrial precursor SP:O64948 from [Arabidopsis thaliana] Length = 888 Score = 34.3 bits (75), Expect = 0.027 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTKGPFCPMGG 366 L GPPG GKT++A +IA LG K +GG Sbjct: 404 LCFVGPPGVGKTSLASSIAAALGRKFVRLSLGG 436 >At3g05530.1 68416.m00606 26S proteasome AAA-ATPase subunit (RPT5a) identical to GB:AAF22525 GI:6652886 from [Arabidopsis thaliana] Length = 424 Score = 34.3 bits (75), Expect = 0.027 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 6/89 (6%) Frame = +1 Query: 127 SHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMAR------RALLLAGPP 288 S +K + +DE G + ++ IV+ M ++ + + +LL GPP Sbjct: 155 SRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFEKLGVRPPKGVLLYGPP 214 Query: 289 GTGKTAIALAIAQELGTKGPFCPMGGSEV 375 GTGKT +A A A + T F + G ++ Sbjct: 215 GTGKTLMARACAAQ--TNATFLKLAGPQL 241 >At4g36580.1 68417.m05193 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 620 Score = 33.9 bits (74), Expect = 0.036 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 6/51 (11%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQELG------TKGPFCPMGGSEV 375 +S + R ++ GPPGTGKT +A IA++ G T G P+G V Sbjct: 364 KSHQAPFRNMMFYGPPGTGKTMVAREIARKSGLDYAMMTGGDVAPLGSQAV 414 >At4g04910.1 68417.m00714 AAA-type ATPase family protein similar to SP|P18708 Vesicular-fusion protein NSF (N-ethylmaleimide-sensitive fusion protein) (NEM-sensitive fusion protein) {Cricetulus griseus}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; contains non-consensus AT-AC splice sites at intron 2 Length = 742 Score = 33.9 bits (74), Expect = 0.036 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGP 348 + +LL GPPGTGKT +A I + L K P Sbjct: 251 KGMLLFGPPGTGKTLMARQIGKMLNGKDP 279 Score = 26.6 bits (56), Expect = 5.5 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 217 AGIVVDMIR-SKKMARRALLLAGPPGTGKTAIALAI 321 A ++V+ ++ S + LL GP G+GKTA+A I Sbjct: 515 AMLLVEQVKVSTRSPLVTCLLEGPSGSGKTALAATI 550 >At3g50940.1 68416.m05577 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 451 Score = 33.9 bits (74), Expect = 0.036 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R K +R LL GPPGTGK+++ AIA L Sbjct: 241 RVGKAWKRGYLLYGPPGTGKSSLIAAIANHL 271 >At3g16290.1 68416.m02056 FtsH protease, putative contains similarity to cell division protein FtsH GI:1652085 from [Synechocystis sp. PCC 6803] Length = 876 Score = 33.9 bits (74), Expect = 0.036 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELG 336 +LL GPPG GKT +A A+A E G Sbjct: 446 ILLCGPPGVGKTLLAKAVAGEAG 468 >At3g04340.1 68416.m00459 FtsH protease family protein similar to chloroplast FtsH protease [Arabidopsis thaliana] GI:1483215; contains Pfam profiles PF01434: Peptidase family M41, PF00004: ATPase AAA family Length = 960 Score = 33.9 bits (74), Expect = 0.036 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +1 Query: 199 ESAREAAGIVVDMIRSKKM-------ARRALLLAGPPGTGKTAIALAIAQE 330 ES RE VV +++ K A R +L+ G GTGKT++ALAIA E Sbjct: 430 ESMREEINEVVAFLQNPKAFQEMGARAPRGVLIVGERGTGKTSLALAIAAE 480 >At1g09100.1 68414.m01016 26S protease regulatory subunit 6A, putative identical to SP:O04019 from [Arabidopsis thaliana] Length = 423 Score = 33.9 bits (74), Expect = 0.036 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 6/89 (6%) Frame = +1 Query: 127 SHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMAR------RALLLAGPP 288 S +K + +DE G + ++ IV+ M ++ + + +LL GPP Sbjct: 154 SRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKEQFEKLGIRPPKGVLLYGPP 213 Query: 289 GTGKTAIALAIAQELGTKGPFCPMGGSEV 375 GTGKT +A A A + T F + G ++ Sbjct: 214 GTGKTLMARACAAQ--TNATFLKLAGPQL 240 >At5g58870.1 68418.m07376 FtsH protease, putative contains similarity to cell division protein FtsH homolog 3 SP:P73437 (EC 3.4.24.-) [strain PCC6803] {Synechocystis sp.} Length = 806 Score = 33.5 bits (73), Expect = 0.048 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 7/71 (9%) Frame = +1 Query: 181 AGLVGQESAREAAGIVVDMIRSKKM-----AR--RALLLAGPPGTGKTAIALAIAQELGT 339 A + G + A+E +V+ +++ AR R +LL G PGTGKT +A A+A E + Sbjct: 329 ADVAGVDEAKEELEEIVEFLKNPDRYVRLGARPPRGVLLVGLPGTGKTLLAKAVAGE--S 386 Query: 340 KGPFCPMGGSE 372 PF SE Sbjct: 387 DVPFISCSASE 397 >At5g43010.1 68418.m05245 26S proteasome AAA-ATPase subunit (RPT4a) gb|AAF22524.1 Length = 399 Score = 33.5 bits (73), Expect = 0.048 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQEL 333 + +LL GPPGTGKT +A AIA + Sbjct: 174 KGVLLYGPPGTGKTLLARAIASNI 197 >At4g30250.1 68417.m04301 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 512 Score = 33.5 bits (73), Expect = 0.048 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQELG 336 +R LL GPPGTGK+++ A+A LG Sbjct: 238 KRGYLLYGPPGTGKSSLIAAMANYLG 263 >At3g03060.1 68416.m00302 AAA-type ATPase family protein contains a ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 639 Score = 33.5 bits (73), Expect = 0.048 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 6/44 (13%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG------TKGPFCPMGGSEV 375 R +LL GPPGTGKT A +A++ G T G P+G V Sbjct: 398 RNILLHGPPGTGKTMAARELARKSGLDYALMTGGDVAPLGAQAV 441 >At1g45000.1 68414.m05158 26S proteasome regulatory complex subunit p42D, putative similar to 26S proteasome regulatory complex subunit p42D [Drosophila melanogaster] gi|6434958|gb|AAF08391 Length = 399 Score = 33.5 bits (73), Expect = 0.048 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQEL 333 + +LL GPPGTGKT +A AIA + Sbjct: 174 KGVLLYGPPGTGKTLLARAIASNI 197 >At5g57480.1 68418.m07183 AAA-type ATPase family protein contains Pfam profile: PF00004 ATPase family Length = 520 Score = 33.1 bits (72), Expect = 0.063 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQELG 336 +R LL GPPGTGK+++ A+A LG Sbjct: 237 KRGYLLYGPPGTGKSSMIAAMANYLG 262 >At3g56690.1 68416.m06306 calmodulin-binding protein identical to calmodulin-binding protein GI:6760428 from [Arabidopsis thaliana] Length = 1022 Score = 33.1 bits (72), Expect = 0.063 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 + +L+ GPPGTGKT++A A+ G F + G E+ Sbjct: 419 KGVLIHGPPGTGKTSLARTFARHSGVN--FFSVNGPEI 454 >At1g73170.1 68414.m08466 expressed protein Length = 666 Score = 33.1 bits (72), Expect = 0.063 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +1 Query: 202 SAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELG 336 S R +A ++ D+++ +LLL GPPG GKT + +A+ LG Sbjct: 182 SVRGSANLLRDLVQDGN----SLLLIGPPGVGKTTMIREVARMLG 222 >At3g50930.1 68416.m05576 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 576 Score = 32.7 bits (71), Expect = 0.083 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R K +R LL GPPGTGK+++ A+A L Sbjct: 293 RVGKAWKRGYLLYGPPGTGKSSLIAAMANHL 323 >At5g26860.1 68418.m03204 Lon protease homolog 2, mitochondrial almost identical to Lon protease homolog 2 mitochondrial precursor SP:P93655, GI:1848290 from [Arabidopsis thaliana] Length = 940 Score = 32.3 bits (70), Expect = 0.11 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 223 IVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELGTK 342 I V +R + + L+GPPG GKT+I +IA+ L K Sbjct: 446 IAVGRLRGTSQGK-IICLSGPPGVGKTSIGRSIARALNRK 484 >At5g17760.2 68418.m02083 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 341 Score = 32.3 bits (70), Expect = 0.11 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R K +R LL GPPGTGK+++ A+A L Sbjct: 247 RVGKAWKRGYLLYGPPGTGKSSLVAAMANYL 277 >At5g17760.1 68418.m02082 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 505 Score = 32.3 bits (70), Expect = 0.11 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R K +R LL GPPGTGK+++ A+A L Sbjct: 247 RVGKAWKRGYLLYGPPGTGKSSLVAAMANYL 277 >At5g17740.1 68418.m02080 AAA-type ATPase family protein h-bcs1, Homo sapiens, EMBL:AF026849 h-bcs1, Homo sapiens, EMBL:AF026849 h-bcs1, Homo sapiens, EMBL:AF026849 contains Pfam profile: ATPase family PF00004 gene_id:K17E7.100 contains Pfam profile: ATPase family PF00004 Length = 533 Score = 32.3 bits (70), Expect = 0.11 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R K +R LL GPPGTGK+++ A+A L Sbjct: 239 RVGKAWKRGYLLYGPPGTGKSSLVAAMANYL 269 >At1g62130.1 68414.m07010 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 1025 Score = 32.3 bits (70), Expect = 0.11 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELG 336 +LL GP GTGKT +A A+A E G Sbjct: 773 ILLFGPSGTGKTMLAKAVATEAG 795 >At1g43910.1 68414.m05066 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 475 Score = 32.3 bits (70), Expect = 0.11 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQEL 333 +R LL GPPGTGK+++ AIA + Sbjct: 239 KRGYLLYGPPGTGKSSMVAAIANHM 263 >At4g05380.1 68417.m00820 AAA-type ATPase family protein contains similarity to mitochondrial ATPase (AAA family) Bcs1p, Saccharomyces cerevisiae, Swiss Prot:P32839 Length = 248 Score = 31.9 bits (69), Expect = 0.15 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIA 324 +R LL GPPGTGK+++ AIA Sbjct: 31 KRGYLLYGPPGTGKSSLVAAIA 52 >At3g05780.1 68416.m00649 Lon protease, putative similar to Lon protease homolog 2 SP:P93655 Length = 924 Score = 31.9 bits (69), Expect = 0.15 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 223 IVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELGTK 342 I V +R + + L+GPPG GKT+I +IA+ L K Sbjct: 429 IAVGRLRGTSQGK-IICLSGPPGVGKTSIGRSIARALDRK 467 >At2g18193.1 68415.m02117 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 495 Score = 31.9 bits (69), Expect = 0.15 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R K +R LL GPPGTGK+++ A+A L Sbjct: 237 RVGKAWKRGYLLYGPPGTGKSSLIAAMANYL 267 >At2g18190.1 68415.m02116 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 494 Score = 31.9 bits (69), Expect = 0.15 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R K +R LL GPPGTGK+++ A+A L Sbjct: 238 RVGKAWKRGYLLYGPPGTGKSSLIAAMANYL 268 >At1g53750.1 68414.m06115 26S proteasome AAA-ATPase subunit (RPT1a) similar to 26S proteasome ATPase subunit GI:1395190 from [Spinacia oleracea] Length = 426 Score = 31.9 bits (69), Expect = 0.15 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 + +L GPPGTGKT +A A+A T F + GSE+ Sbjct: 203 KGVLCYGPPGTGKTLLARAVANR--TDACFIRVIGSEL 238 >At5g22010.1 68418.m02561 AAA-type ATPase family protein / BRCT domain-containing protein contains Pfam profiles: PF00533 BRCA1 C Terminus (BRCT) domain, PF00004 ATPase family associated with various cellular activities (AAA) Length = 956 Score = 31.5 bits (68), Expect = 0.19 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +1 Query: 256 ARRALLLAGPPGTGKTAIALAIAQELG 336 +++A+LL+G PG GKT A ++Q LG Sbjct: 392 SKKAVLLSGTPGIGKTTSAKLVSQMLG 418 >At5g16930.1 68418.m01984 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 644 Score = 31.5 bits (68), Expect = 0.19 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 6/44 (13%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELG------TKGPFCPMGGSEV 375 R +L GPPGTGKT A +A+ G T G P+G V Sbjct: 399 RNILFYGPPGTGKTMAARELARRSGLDYALMTGGDVAPLGAQAV 442 >At4g29040.1 68417.m04153 26S proteasome AAA-ATPase subunit (RPT2a) almost identical to 26S proteasome AAA-ATPase subunit RPT2a (GI:6652880) {Arabidopsis thaliana}; Drosophila melanogaster 26S proteasome subunit 4 ATPase, PID:g1066065 Length = 443 Score = 31.5 bits (68), Expect = 0.19 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 + ++L G PGTGKT +A A+A T F + GSE+ Sbjct: 223 KGVILYGEPGTGKTLLAKAVAN--STSATFLRVVGSEL 258 >At4g25835.1 68417.m03716 AAA-type ATPase family protein contains Pfam profile: PF00004 ATPase family Length = 506 Score = 31.5 bits (68), Expect = 0.19 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R+ + +R LL GPPGTGK+++ A+A L Sbjct: 231 RTGRAWKRGYLLYGPPGTGKSSMIAAMANYL 261 >At3g28600.1 68416.m03570 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 475 Score = 31.5 bits (68), Expect = 0.19 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 250 KMARRALLLAGPPGTGKTAIALAIAQEL 333 K +R LL GPPGTGK+ + A+A L Sbjct: 233 KAWKRGYLLHGPPGTGKSTMIAAMANHL 260 >At2g20140.1 68415.m02353 26S protease regulatory complex subunit 4, putative similar to Swiss-Prot:P48601 26S protease regulatory subunit 4 (P26S4) [Drosophila melanogaster] Length = 443 Score = 31.5 bits (68), Expect = 0.19 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 + ++L G PGTGKT +A A+A T F + GSE+ Sbjct: 223 KGVILYGEPGTGKTLLAKAVAN--STSATFLRVVGSEL 258 >At1g53780.1 68414.m06120 26S proteasome AAA-ATPase subunit, putative similar to 26S proteasome AAA-ATPase subunit RPT1 SP:Q41365 from [Spinacia oleracea] Length = 464 Score = 31.5 bits (68), Expect = 0.19 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFCPMGGSEV 375 + +L GPPG+GKT +A A+A G F + GSE+ Sbjct: 240 KGVLCYGPPGSGKTLVARAVANRTG--ACFIRVVGSEL 275 >At1g15520.1 68414.m01867 ABC transporter family protein similar to ABC1 protein GI:14331118 from [Nicotiana plumbaginifolia] Length = 1423 Score = 31.5 bits (68), Expect = 0.19 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +1 Query: 223 IVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 I+ D+ K R ALLL GPP +GKT + LA+A +L Sbjct: 169 ILNDVSGIVKPGRMALLL-GPPSSGKTTLLLALAGKL 204 >At5g17750.1 68418.m02081 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 392 Score = 31.1 bits (67), Expect = 0.25 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R K +R+ L GPPGTGK+++ A+A L Sbjct: 214 RVGKAWKRSYFLYGPPGTGKSSLVAAMANYL 244 >At4g15236.1 68417.m02335 ABC transporter family protein similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, ABC1 protein [Nicotiana plumbaginifolia] GI:14331118; contains Pfam profile PF00005: ABC transporter Length = 1388 Score = 31.1 bits (67), Expect = 0.25 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQEL 333 +R LL GPPG GKT + LA++ L Sbjct: 162 KRMTLLLGPPGCGKTTLLLALSGRL 186 >At3g28510.1 68416.m03561 AAA-type ATPase family protein contains Pfam profile: PF00004 ATPase family Length = 530 Score = 31.1 bits (67), Expect = 0.25 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQEL 333 +R LL GPPGTGK+ + AIA L Sbjct: 243 KRGYLLFGPPGTGKSTMIAAIANFL 267 >At2g29940.1 68415.m03642 ABC transporter family protein similar to ABC1 protein GI:14331118 from [Nicotiana plumbaginifolia] Length = 1426 Score = 31.1 bits (67), Expect = 0.25 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQEL 333 R LL GPPG+GK+ + LA+A +L Sbjct: 187 RMTLLLGPPGSGKSTLLLALAGKL 210 >At5g47010.1 68418.m05794 RNA helicase, putative similar to type 1 RNA helicase pNORF1 [Homo sapiens] GI:1885356 Length = 1254 Score = 30.7 bits (66), Expect = 0.34 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQELGTKG 345 L+ GPPGTGKT + AI + +G Sbjct: 507 LIQGPPGTGKTVTSAAIVYHMAKQG 531 >At3g28520.1 68416.m03562 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 478 Score = 30.7 bits (66), Expect = 0.34 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQEL 333 +R LL GPPGTGK+ + AIA L Sbjct: 228 KRGYLLFGPPGTGKSTMISAIANFL 252 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 30.7 bits (66), Expect = 0.34 Identities = 14/39 (35%), Positives = 27/39 (69%) Frame = +1 Query: 226 VVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELGTK 342 V+ ++R+ ++++ +LL G PG GKT++ LA+ + G K Sbjct: 1735 VLRVLRAMQLSK-PILLEGSPGVGKTSLILALGKYSGHK 1772 Score = 30.3 bits (65), Expect = 0.44 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 232 DMIRSKKMARRALLLAGPPGTGKTAIALAIAQELGTKGPFCPM 360 +M+ +R +LL GP G+GK+A+ +A E G F M Sbjct: 344 EMVSLAVSQKRPVLLYGPSGSGKSALIRKLADESGNHVVFIHM 386 >At5g40010.1 68418.m04852 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 514 Score = 30.3 bits (65), Expect = 0.44 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 250 KMARRALLLAGPPGTGKTAIALAIAQEL 333 K +R LL GPPGTGK+ + A+A L Sbjct: 240 KAWKRGYLLFGPPGTGKSTMIAAMANLL 267 >At3g28610.1 68416.m03571 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 473 Score = 30.3 bits (65), Expect = 0.44 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 250 KMARRALLLAGPPGTGKTAIALAIAQEL 333 K +R LL GPPGTGK+ + A+A L Sbjct: 233 KAWKRGYLLYGPPGTGKSTMIAAMANLL 260 >At3g28580.1 68416.m03568 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 500 Score = 30.3 bits (65), Expect = 0.44 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 250 KMARRALLLAGPPGTGKTAIALAIAQEL 333 K +R LL GPPGTGK+ + A+A L Sbjct: 237 KAWKRGYLLFGPPGTGKSTMIAAMANFL 264 >At3g28570.1 68416.m03567 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 451 Score = 30.3 bits (65), Expect = 0.44 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIA 324 R K +R LL GPPGTGK+ + A+A Sbjct: 230 RIGKAWKRGYLLYGPPGTGKSTMIAAMA 257 >At3g16340.1 68416.m02066 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza]; contains Pfam profile: PF00005 ABC transporter Length = 1416 Score = 30.3 bits (65), Expect = 0.44 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQEL 333 R LL GPP +GKT + LA+A +L Sbjct: 174 RMTLLLGPPSSGKTTLLLALAGKL 197 >At1g66950.1 68414.m07612 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1454 Score = 30.3 bits (65), Expect = 0.44 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +1 Query: 202 SAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 S R+ I+ D+ K +R LLL GPP +GKT + A+A +L Sbjct: 183 SKRKKIQILKDISGIVKPSRMTLLL-GPPSSGKTTLLQALAGKL 225 >At5g40000.1 68418.m04851 AAA-type ATPase family protein BCS1 nuclear gene encoding mitochondrial protein - Homo sapiens, EMBL:AF026849 contains Pfam profile: ATPase family PF00004 Length = 470 Score = 29.9 bits (64), Expect = 0.59 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 250 KMARRALLLAGPPGTGKTAIALAIAQEL 333 K +R LL GPPGTGK+ + A+A L Sbjct: 238 KAWKRGYLLYGPPGTGKSTMISAMANLL 265 >At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1607 Score = 29.9 bits (64), Expect = 0.59 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = +1 Query: 157 NGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 N + GLVG E+ E ++ + +K R + + G PG+GKT IA + Q+L Sbjct: 258 NSTQSSASQGLVGMEAHMEKMKELLGLDSNKV---RLIGICGLPGSGKTTIAKRLYQQL 313 >At3g45450.1 68416.m04908 Clp amino terminal domain-containing protein contains Pfam profile: PF02861 Clp amino terminal domain Length = 341 Score = 29.9 bits (64), Expect = 0.59 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 229 VDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELGT 339 V I +++ R L G PG GK AIA IAQ + + Sbjct: 166 VVQILARRTCRNNACLIGKPGVGKRAIAEGIAQRIAS 202 >At4g19500.1 68417.m02868 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. A false intron was added between exons 2 and 3 to circumvent a frameshift caused by a sequencing error, as per Blake Meyers (bcmeyers@vegmail.ucdavis.edu) Length = 1308 Score = 29.5 bits (63), Expect = 0.78 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = +1 Query: 187 LVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 +VG E+ EA + +R K R + ++GP G GKT IA A+ +L Sbjct: 183 IVGIEAHLEAMSSI---LRLKSEKARMVGISGPSGIGKTTIAKALFSKL 228 >At3g28540.1 68416.m03564 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 510 Score = 29.5 bits (63), Expect = 0.78 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQEL 333 +R LL GPPGTGK+ + A+A L Sbjct: 239 KRGYLLFGPPGTGKSTMISAMANFL 263 >At5g66005.2 68418.m08311 Expressed protein Length = 164 Score = 29.1 bits (62), Expect = 1.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGP 348 + LL+ GPPG GKT + + + + P Sbjct: 6 KCLLVTGPPGVGKTTLIMRVLDMMRVSNP 34 >At3g44400.1 68416.m04770 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1007 Score = 29.1 bits (62), Expect = 1.0 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 6/50 (12%) Frame = +1 Query: 220 GIVVDMIRSKKMAR------RALLLAGPPGTGKTAIALAIAQELGTKGPF 351 G+ M R++++ R R + + GPPG GKT IA + + PF Sbjct: 215 GMAAHMERTEQLLRLDLDEVRMIGILGPPGIGKTTIATCMFDRFSRRFPF 264 >At2g03270.1 68415.m00280 DNA-binding protein, putative similar to Swiss-Prot:Q60560 DNA-binding protein SMUBP-2 (Immunoglobulin MU binding protein 2) (SMUBP-2) (Insulin II gene enhancer-binding protein)(RIPE3B-binding complex 3B2 P110 subunit) (RIP-1)[Mesocricetus auratus]; identical to putative helicase (atpc-2 gene) cDNA NCBI_gi:11191230 Length = 639 Score = 29.1 bits (62), Expect = 1.0 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 232 DMIRSKKMARRALLLAGPPGTGKTAIALAIAQELGTKG 345 D I ++ LL GPPGTGKT + I + +G Sbjct: 196 DAITKALSSKDVFLLHGPPGTGKTTTVVEIVLQEVKRG 233 >At1g77620.1 68414.m09037 expressed protein Length = 1151 Score = 29.1 bits (62), Expect = 1.0 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQELGTK 342 + LL+ GP G+GK+A A A+E G K Sbjct: 385 KNVLLIVGPAGSGKSAAIHACAKEQGFK 412 >At5g66910.1 68418.m08434 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 815 Score = 28.7 bits (61), Expect = 1.4 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +1 Query: 238 IRSKKMARRALLLAGPPGTGKTAIALAIAQELGTKGPF 351 ++ K + ++++GPPG GKT + + + +G F Sbjct: 182 LKKKLLDNSVVVVSGPPGCGKTTLVTKLCDDPEIEGEF 219 >At5g41540.1 68418.m05048 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1038 Score = 28.7 bits (61), Expect = 1.4 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 280 GPPGTGKTAIALAIAQELGTKGPF-CPMG 363 GP G GKT IA A+ +L T F C MG Sbjct: 212 GPAGIGKTTIARALYNQLSTNFQFKCFMG 240 >At5g37160.1 68418.m04461 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 871 Score = 28.7 bits (61), Expect = 1.4 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +1 Query: 202 SAREAAGIVVDMIRSKKMARRALLLAGPPGTGKT---AIALAIAQELGTKGPFC 354 S++EAA + R+ K L+ GPPGTGKT A L+ +L K C Sbjct: 246 SSQEAAILGFLKTRNCKHKESVKLIWGPPGTGKTKTVATLLSTLMQLKCKTVVC 299 >At4g15233.1 68417.m02334 ABC transporter family protein similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1168 Score = 28.7 bits (61), Expect = 1.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQEL 333 +R LL GPP GKT + LA++ L Sbjct: 164 KRMTLLLGPPSCGKTTLLLALSGRL 188 >At4g14670.1 68417.m02255 heat shock protein 101, putative / HSP101, putative similar to heat shock protein 101 GI:6715468 GB:AAF26423 from [Arabidopsis thaliana] Length = 623 Score = 28.7 bits (61), Expect = 1.4 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = +1 Query: 187 LVGQESAREAAGIVVDMIR----SKKMARRALLLAGPPGTGKTAIALAIAQEL 333 +VGQ+ A +A + R + + L GP G GKT +A A+A++L Sbjct: 536 VVGQDEAVKAVAAAILRSRVGLGRPQQPSGSFLFLGPTGVGKTELAKALAEQL 588 Score = 26.2 bits (55), Expect = 7.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQEL 333 +L G PG GKTA+ +AQ + Sbjct: 169 VLIGEPGVGKTAVVEGLAQRI 189 >At5g50920.1 68418.m06315 ATP-dependent Clp protease ATP-binding subunit / ClpC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif Length = 929 Score = 28.3 bits (60), Expect = 1.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 274 LAGPPGTGKTAIALAIAQELGT 339 L G PG GKTAIA +AQ + + Sbjct: 300 LIGEPGVGKTAIAEGLAQRIAS 321 >At5g37140.1 68418.m04458 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 692 Score = 28.3 bits (60), Expect = 1.8 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +1 Query: 202 SAREAAGIVVDMIRSKKMARRALLLAGPPGTGKT 303 S++EAA + IR+ L+ GPPGTGKT Sbjct: 76 SSQEAAILSCLKIRNCNHKHSVKLIWGPPGTGKT 109 >At5g20040.2 68418.m02385 tRNA isopentenyltransferase 9 / IPP transferase 9 (IPT9) identical to tRNA isopentenyltransferase (IPT9) [Arabidopsis thaliana] GI:14279070 Length = 459 Score = 28.3 bits (60), Expect = 1.8 Identities = 12/45 (26%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +1 Query: 202 SAREAAGIVVDMIRSKKMAR-RALLLAGPPGTGKTAIALAIAQEL 333 +A A + ++ + KK + + ++++GP G GK+ +A+ +A+ L Sbjct: 30 AATTACSVPLNGNKKKKSEKEKVIVISGPTGAGKSRLAMELAKRL 74 >At5g20040.1 68418.m02384 tRNA isopentenyltransferase 9 / IPP transferase 9 (IPT9) identical to tRNA isopentenyltransferase (IPT9) [Arabidopsis thaliana] GI:14279070 Length = 463 Score = 28.3 bits (60), Expect = 1.8 Identities = 12/45 (26%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +1 Query: 202 SAREAAGIVVDMIRSKKMAR-RALLLAGPPGTGKTAIALAIAQEL 333 +A A + ++ + KK + + ++++GP G GK+ +A+ +A+ L Sbjct: 30 AATTACSVPLNGNKKKKSEKEKVIVISGPTGAGKSRLAMELAKRL 74 >At5g18370.1 68418.m02161 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1210 Score = 28.3 bits (60), Expect = 1.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPF 351 R + + GPPG GKT IA + ++ K F Sbjct: 256 RMIGILGPPGIGKTTIARVLYDQISEKFQF 285 >At5g18350.1 68418.m02159 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1193 Score = 28.3 bits (60), Expect = 1.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQEL 333 R + + GPPG GKT IA A+ ++ Sbjct: 215 RMIGIVGPPGIGKTTIARALRDQI 238 >At5g08470.1 68418.m00999 peroxisome biogenesis protein (PEX1) identical to peroxisome biogenesis protein PEX1 [Arabidopsis thaliana] gi|12006272|gb|AAG44817; contains Pfam profile PF00004: ATPase, AAA family; identical to cDNA peroxisome biogenesis protein PEX1 (PEX1) mRNA, partial cds GI:12006271 Length = 1130 Score = 28.3 bits (60), Expect = 1.8 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQ 327 +L+ GPPG+GKT +A A A+ Sbjct: 596 ILIYGPPGSGKTILARAAAK 615 Score = 26.6 bits (56), Expect = 5.5 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIA 324 +S R +LL GPPG GKT I A A Sbjct: 872 KSPLRLRSNVLLYGPPGCGKTHIVGAAA 899 >At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding subunit (ClpC) identical to AtClpC GI:5360574 from [Arabidopsis thaliana]; contains Pfam profiles PF02861: Clp amino terminal domain and PF02151: UvrB/uvrC motif Length = 952 Score = 28.3 bits (60), Expect = 1.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 274 LAGPPGTGKTAIALAIAQELGT 339 L G PG GKTAIA +AQ + + Sbjct: 321 LIGEPGVGKTAIAEGLAQRIAS 342 >At3g24530.1 68416.m03080 AAA-type ATPase family protein / ankyrin repeat family protein contains Pfam profiles: PF00023 ankyrin repeat, PF00004 ATPase family associated with various cellular activities (AAA) Length = 481 Score = 28.3 bits (60), Expect = 1.8 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = +1 Query: 142 LGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAI 321 +GL E ++ A + + R A G+ + R MA G PGTGKT +A + Sbjct: 211 VGLSELKTQLRKWAKGMLLDERRRALGLNIGTRRPPHMA-----FLGNPGTGKTMVARVL 265 Query: 322 AQELGTKG 345 + L T G Sbjct: 266 GKLLNTVG 273 >At3g05790.1 68416.m00650 Lon protease, putative similar to Lon protease homolog 2 SP:P93655 Length = 942 Score = 28.3 bits (60), Expect = 1.8 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTK 342 + + L+GP G GKT+I +IA+ L K Sbjct: 450 KIICLSGPTGVGKTSIGRSIARALDRK 476 >At2g36380.1 68415.m04464 ABC transporter family protein related to multi drug resistance proteins and P-glycoproteins Length = 1453 Score = 28.3 bits (60), Expect = 1.8 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +1 Query: 202 SAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 S + I+ D+ K +R LLL GPP +GKT + A+A +L Sbjct: 181 SKKRKIEILKDISGIIKPSRMTLLL-GPPSSGKTTLLQALAGKL 223 >At1g35750.1 68414.m04445 pumilio/Puf RNA-binding domain-containing protein Length = 528 Score = 28.3 bits (60), Expect = 1.8 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = -1 Query: 204 RLLTHETGCHLNR----NTIFIQPQAFYMTVSRDPLRFS 100 +L TH+ GC++ + NT+ +Q + +SRD LR S Sbjct: 368 QLATHQYGCYVLQCSLINTVGLQHERLVAEISRDSLRLS 406 >At5g60340.1 68418.m07564 maoC-like dehydratase domain-containing protein contains similarity to (R)-specific enoyl-CoA hydratase PhaJ1 [Pseudomonas oleovorans] gi|22506675|gb|AAM97601; contains Pfam domain PF01575: MaoC like domain Length = 337 Score = 27.9 bits (59), Expect = 2.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQ 327 R LL+ G PGTGK+ A A+A+ Sbjct: 13 RPNLLITGTPGTGKSTTASALAE 35 >At5g51070.1 68418.m06330 ATP-dependent Clp protease ATP-binding subunit (ClpD), (ERD1) SAG15/ERD1; identical to ERD1 protein GI:497629, SP:P42762 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino terminal domain Length = 945 Score = 27.9 bits (59), Expect = 2.4 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 4/86 (4%) Frame = +1 Query: 79 IEEVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRS--KK 252 + V S Q+I+A + + L++ Q+ +VGQ+ A A V R K Sbjct: 598 VASVWSGIPVQQITADERMLLMSLED-----QLRGRVVGQDEAVAAISRAVKRSRVGLKD 652 Query: 253 MAR--RALLLAGPPGTGKTAIALAIA 324 R A+L GP G GKT + A+A Sbjct: 653 PDRPIAAMLFCGPTGVGKTELTKALA 678 >At4g15570.1 68417.m02379 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 818 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAI 321 +L+ GPPGTGKT L+I Sbjct: 276 VLIQGPPGTGKTQTILSI 293 >At4g15215.1 68417.m02332 ABC transporter family protein similar to PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1390 Score = 27.9 bits (59), Expect = 2.4 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQEL 333 R LL GPPG GKT + A++ L Sbjct: 165 RMTLLLGPPGCGKTTLLQALSGRL 188 >At2g46620.1 68415.m05815 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 491 Score = 27.9 bits (59), Expect = 2.4 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 241 RSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 R ++ +R+ LL GP GTGK++ A+A L Sbjct: 225 RLGRVWKRSYLLYGPSGTGKSSFVAAMANFL 255 >At2g37280.1 68415.m04573 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1413 Score = 27.9 bits (59), Expect = 2.4 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQEL 333 R LL GPPG GKT + A++ L Sbjct: 166 RLTLLLGPPGCGKTTLLKALSGNL 189 >At2g34470.1 68415.m04231 urease accessory protein (UREG) identical to urease accessory protein UREG GI:4324678 from [Arabidopsis thaliana]; contains Pfam profile: PF01495 HypB/UreG nucleotide-binding domain Length = 275 Score = 27.9 bits (59), Expect = 2.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 274 LAGPPGTGKTAIALAIAQELGTK 342 + GP GTGKTA+ LA+ + L K Sbjct: 78 IGGPVGTGKTALMLALCRFLRDK 100 >At2g07710.1 68415.m00998 hypothetical protein Length = 150 Score = 27.9 bits (59), Expect = 2.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 214 PHVQTLDPRDRLPFE*EHHFHPTPSLLYDCEQRS 113 PH +LDP L + E H HP ++ DC+ +S Sbjct: 84 PHHHSLDPS--LCHQVEFHHHPPLDIILDCQLQS 115 >At1g74310.1 68414.m08605 heat shock protein 101 (HSP101) identical to heat shock protein 101 GI:6715468 GB:AAF26423 from [Arabidopsis thaliana] Length = 911 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 265 ALLLAGPPGTGKTAIALAIAQEL 333 + L GP G GKT +A A+A++L Sbjct: 601 SFLFLGPTGVGKTELAKALAEQL 623 Score = 26.2 bits (55), Expect = 7.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQEL 333 +L G PG GKTA+ +AQ + Sbjct: 204 VLIGEPGVGKTAVVEGLAQRI 224 >At1g63880.1 68414.m07234 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1017 Score = 27.9 bits (59), Expect = 2.4 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 157 NGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAI 321 N P + G+VG E+ ++D+ + + + +AGP G GKT IA A+ Sbjct: 177 NATPSRDFDGMVGIEAHLREIKSLLDL---DNVEVKIVAIAGPAGIGKTTIARAL 228 >At1g16800.1 68414.m02018 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 1939 Score = 27.9 bits (59), Expect = 2.4 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQEL 333 L+ GPPGTGKT +AI L Sbjct: 1128 LIQGPPGTGKTRTIVAIISGL 1148 >At1g03030.1 68414.m00275 phosphoribulokinase/uridine kinase family protein contains Pfam PF00485: Phosphoribulokinase / Uridine kinase family; Belongs to Interpro IPR006083 Phosphoribulokinase/uridine kinase family; similar to Uridine kinase (Uridine monophosphokinase) (SP:P27515) {Saccharomyces cerevisiae}; ESTs gb|AA585719, gb|AA728503 and gb|T22272 come from this gene Length = 301 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQELGTKGP 348 +R + LAGPPG GK+ +A + + + P Sbjct: 95 KRLVGLAGPPGAGKSTVANEVVRRVNKLWP 124 >At4g26090.1 68417.m03756 disease resistance protein RPS2 (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. identical to RPS2 (gi:13661831) Length = 909 Score = 27.5 bits (58), Expect = 3.1 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 244 SKKMARRALLLAGPPGTGKTAIALAIAQELGTKG 345 S++ R + + GP G GKT + +I EL TKG Sbjct: 170 SEEEERGIIGVYGPGGVGKTTLMQSINNELITKG 203 >At4g16990.3 68417.m02563 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 801 Score = 27.5 bits (58), Expect = 3.1 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 166 PIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 P + VG E+ EA ++ M+R R + + GP TGKT I A+ L Sbjct: 174 PSNNFSDFVGIEAHIEA---LISMLRFDSKKARMIGICGPSETGKTTIGRALYSRL 226 >At4g16990.2 68417.m02562 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 796 Score = 27.5 bits (58), Expect = 3.1 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 166 PIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 P + VG E+ EA ++ M+R R + + GP TGKT I A+ L Sbjct: 174 PSNNFSDFVGIEAHIEA---LISMLRFDSKKARMIGICGPSETGKTTIGRALYSRL 226 >At4g16990.1 68417.m02561 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 520 Score = 27.5 bits (58), Expect = 3.1 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 166 PIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 P + VG E+ EA ++ M+R R + + GP TGKT I A+ L Sbjct: 174 PSNNFSDFVGIEAHIEA---LISMLRFDSKKARMIGICGPSETGKTTIGRALYSRL 226 >At4g14700.1 68417.m02259 replication control protein, putative similar to origin recognition complex subunit 1 (Replication control protein 1) [Homo sapiens] SWISS-PROT:Q13415 Length = 809 Score = 27.5 bits (58), Expect = 3.1 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = +1 Query: 211 EAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQ------ELGTKGPFC 354 E + I + R + + G PGTGKT L++ + E G+ P+C Sbjct: 443 EITAFIKGSISDDQCLGRCMYIHGVPGTGKTISVLSVMKNLKAEVEAGSVSPYC 496 >At4g12620.1 68417.m01988 replication control protein, putative similar to origin recognition complex subunit 1 (Replication control protein 1)[Homo sapiens] SWISS-PROT:Q13415 Length = 813 Score = 27.5 bits (58), Expect = 3.1 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = +1 Query: 211 EAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL------GTKGPFC 354 E + I + R + + G PGTGKT L++ + L G+ P+C Sbjct: 448 EITSFIKGSISDDQCLGRCMYIHGVPGTGKTISVLSVMKNLKAEVEEGSVSPYC 501 >At3g15120.1 68416.m01913 AAA-type ATPase family protein contains PROSITE domains, PS00674: AAA-protein family signature and PS00017: ATP/GTP-binding site motif A (P-loop) Length = 1954 Score = 27.5 bits (58), Expect = 3.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQEL 333 R +LL G PGTGKT + A+ L Sbjct: 754 RGILLHGHPGTGKTLVVRALIGSL 777 >At2g25140.1 68415.m03007 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 964 Score = 27.5 bits (58), Expect = 3.1 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQEL 333 ++ G PG GKTAIA +AQ + Sbjct: 284 VIIGEPGVGKTAIAEGLAQRI 304 >At1g04730.1 68414.m00469 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 954 Score = 27.5 bits (58), Expect = 3.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAIALAIAQELG 336 ++ LLL G PG GKT +A A+ G Sbjct: 345 QKILLLCGAPGLGKTTLAHIAAKHCG 370 >At5g43140.1 68418.m05266 peroxisomal membrane 22 kDa family protein contains Mpv17 / PMP22 family domain, Pfam:PF04117 Length = 254 Score = 27.1 bits (57), Expect = 4.1 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +1 Query: 169 IQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGP 285 I MAA L Q E G D+IR+ +MA L+ GP Sbjct: 101 IYMAADLTSQMITMEPTGSF-DLIRTARMASFGLIFLGP 138 >At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 968 Score = 27.1 bits (57), Expect = 4.1 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQEL 333 +L G PG GKTAI+ +AQ + Sbjct: 279 VLIGEPGVGKTAISEGLAQRI 299 >At4g15230.1 68417.m02333 ABC transporter family protein similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1326 Score = 27.1 bits (57), Expect = 4.1 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIA 324 R LL GPPG GKT + A++ Sbjct: 168 RMTLLLGPPGCGKTTLLQALS 188 >At3g53480.1 68416.m05904 ABC transporter family protein PDR5-like ABC transporter, Spirodela polyrrhiza, EMBL:Z70524 Length = 1450 Score = 27.1 bits (57), Expect = 4.1 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 187 LVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 L G ++ I+ D+ K R LLL GPP GKT + A++ L Sbjct: 177 LTGAKTHEAKINIINDVNGIIKPGRLTLLL-GPPSCGKTTLLKALSGNL 224 >At3g29800.1 68416.m03792 AAA-type ATPase family contains Pfam profile: ATPase family PF00004 Length = 440 Score = 27.1 bits (57), Expect = 4.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQEL 333 R LL G PG GKT++ AIA+ L Sbjct: 200 RYYLLHGLPGAGKTSLVAAIAKYL 223 >At2g36250.2 68415.m04450 chloroplast division protein FtsZ (FtsZ2-1) identical to chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] GI:15636809, plastid division protein FtsZ [Arabidopsis thaliana] GI:14195704 Length = 478 Score = 27.1 bits (57), Expect = 4.1 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 190 VGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELG 336 +G +ARE+ ++ + + M + G GTG + IA+ +G Sbjct: 186 IGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMG 234 >At2g36250.1 68415.m04449 chloroplast division protein FtsZ (FtsZ2-1) identical to chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] GI:15636809, plastid division protein FtsZ [Arabidopsis thaliana] GI:14195704 Length = 478 Score = 27.1 bits (57), Expect = 4.1 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 190 VGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELG 336 +G +ARE+ ++ + + M + G GTG + IA+ +G Sbjct: 186 IGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMG 234 >At2g14080.1 68415.m01566 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1215 Score = 27.1 bits (57), Expect = 4.1 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +1 Query: 157 NGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELG 336 N P++ GLVG + E +++ + + R + + GPPG GKT I + +L Sbjct: 220 NSTPLRDFDGLVGMGAHMEKLELLLCLDSCEV---RMIGIWGPPGIGKTTIVRFLYNQLS 276 Query: 337 T 339 + Sbjct: 277 S 277 >At1g63870.1 68414.m07233 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1031 Score = 27.1 bits (57), Expect = 4.1 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +1 Query: 157 NGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELG 336 N P + G+VG E+ ++D+ + + ++GP G GKT IA A+ L Sbjct: 180 NATPSRDFNGMVGLEAHLTEMESLLDLDYD---GVKMVGISGPAGIGKTTIARALQSRLS 236 Query: 337 TK 342 K Sbjct: 237 NK 238 >At5g66900.1 68418.m08433 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 809 Score = 26.6 bits (56), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 268 LLLAGPPGTGKTAIALAIAQELGTKGPF 351 L+++ PPG GKT + + + KG F Sbjct: 190 LVVSAPPGCGKTTLVSRLCDDPDIKGKF 217 >At5g53350.1 68418.m06630 ATP-dependent Clp protease ATP-binding subunit ClpX1 (CLPX) identical to CLP protease regulatory subunit CLPX GI:2674203 from [Arabidopsis thaliana] Length = 579 Score = 26.6 bits (56), Expect = 5.5 Identities = 19/75 (25%), Positives = 39/75 (52%) Frame = +1 Query: 103 KTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAG 282 K ++ ++H K + + + + +AG +A+ A +V++ +S +LL G Sbjct: 180 KVLSVAVYNHYKRIYHESSQ---KRSAGETDSTAAKPADDDMVELEKSN------ILLMG 230 Query: 283 PPGTGKTAIALAIAQ 327 P G+GKT +A +A+ Sbjct: 231 PTGSGKTLLAKTLAR 245 >At5g49840.1 68418.m06172 ATP-dependent Clp protease ATP-binding subunit ClpX, putative similar to CLP protease regulatory subunit CLPX GI:2674203 from [Arabidopsis thaliana]; non-consensus splice donor GC at exon 4; non-consensus splice donor AA at exon 7 Length = 606 Score = 26.6 bits (56), Expect = 5.5 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 232 DMIRSKKMARRALLLAGPPGTGKTAIALAIAQ 327 D I ++ + +LL GP G+GKT +A +A+ Sbjct: 253 DNIDHVELDKSNVLLLGPTGSGKTLLAKTLAR 284 >At5g11250.1 68418.m01314 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1189 Score = 26.6 bits (56), Expect = 5.5 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +1 Query: 157 NGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 N P + GLVG + E ++ + + R + + GPPG GKT IA + +L Sbjct: 226 NSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEV---RIIGIWGPPGIGKTTIARVVYNQL 281 >At3g30842.1 68416.m03968 ABC transporter protein, putative similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, ABC1 protein [Nicotiana plumbaginifolia] GI:14331118; contains Pfam profile PF00005: ABC transporter Length = 1406 Score = 26.6 bits (56), Expect = 5.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGT 339 R LL GPPG+GK+ + A++ + T Sbjct: 173 RLTLLLGPPGSGKSTLLKALSGKTET 198 >At2g38770.1 68415.m04760 expressed protein Length = 1509 Score = 26.6 bits (56), Expect = 5.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 271 LLAGPPGTGKTAIALAIAQEL 333 ++ GPPGTGKT A+ I L Sbjct: 884 MVVGPPGTGKTDTAVQILNVL 904 >At1g55700.1 68414.m06378 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 679 Score = 26.6 bits (56), Expect = 5.5 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -1 Query: 225 YPCSLTCRLLTHETGCHLNRNTIFIQPQAFYMTVSR 118 Y C+ C + H C L N IF++P +FY+ R Sbjct: 595 YTCNDYCNVTVH-VSCLLG-NPIFLKPTSFYIKQKR 628 >At1g33290.2 68414.m04118 sporulation protein-related isoform contains non-consensus AT-donor acceptor site at intron 6; similar to Stage III sporulation protein AA. (Swiss-Prot:Q01367) [Bacillus subtilis]; similar to SpoIIIAA (GI:1303904) [Bacillus subtilis]; similar to stage III sporulation protein AA (GI:18145497) [Clostridium perfringens str. 13] Length = 303 Score = 26.6 bits (56), Expect = 5.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 229 VDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 +DM+ +++L G PG GKT + IA+ L Sbjct: 154 IDMLYDLLHYGKSILFVGRPGVGKTTVLREIARVL 188 >At1g33290.1 68414.m04117 sporulation protein-related isoform contains non-consensus AT-donor acceptor site at intron 6; similar to Stage III sporulation protein AA. (Swiss-Prot:Q01367) [Bacillus subtilis]; similar to SpoIIIAA (GI:1303904) [Bacillus subtilis]; similar to stage III sporulation protein AA (GI:18145497) [Clostridium perfringens str. 13] Length = 379 Score = 26.6 bits (56), Expect = 5.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 229 VDMIRSKKMARRALLLAGPPGTGKTAIALAIAQEL 333 +DM+ +++L G PG GKT + IA+ L Sbjct: 154 IDMLYDLLHYGKSILFVGRPGVGKTTVLREIARVL 188 >At5g64150.1 68418.m08055 methylase family protein contains TIGRfam TIGR00536: modification methylase, HemK family Length = 377 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 289 GTGKTAIALAIAQELGTKG 345 GTG AIA+ IA+ LG++G Sbjct: 208 GTGSGAIAIGIAKVLGSRG 226 >At5g45260.1 68418.m05555 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1187 Score = 26.2 bits (55), Expect = 7.2 Identities = 10/38 (26%), Positives = 22/38 (57%) Frame = +1 Query: 226 VVDMIRSKKMARRALLLAGPPGTGKTAIALAIAQELGT 339 + +M+ + + R + + G PG GKT +A A+ ++ + Sbjct: 161 IENMVNKQPIGIRCVGIWGMPGIGKTTLAKAVFDQMSS 198 >At5g35970.1 68418.m04332 DNA-binding protein, putative similar to SWISS-PROT:Q60560 DNA-binding protein SMUBP-2 (Immunoglobulin MU binding protein 2, SMUBP-2) [Mesocricetus auratus] Length = 961 Score = 26.2 bits (55), Expect = 7.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 259 RRALLLAGPPGTGKTAI 309 R +++ GPPGTGKT + Sbjct: 503 RPVMIVQGPPGTGKTGM 519 >At5g15920.1 68418.m01862 structural maintenance of chromosomes (SMC) family protein (MSS2) similar to SMC-related protein MSS2 [Arabidopsis thaliana] GI:9965743; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1053 Score = 26.2 bits (55), Expect = 7.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 250 KMARRALLLAGPPGTGKTAIALAIAQELG 336 K R L+ GP G+GK+++ AIA LG Sbjct: 40 KPGSRLNLVIGPNGSGKSSLVCAIALCLG 68 >At4g31780.2 68417.m04510 1,2-diacylglycerol 3-beta-galactosyltransferase, putative / monogalactosyldiacylglycerol synthase, putative / MGDG synthase, putative similar to MGD synthase type A from Arabidopsis thaliana [gi:9927297], similar to monogalactosyldiacylglycerol synthase, Cucumis sativus, PID:g1805254 Length = 533 Score = 26.2 bits (55), Expect = 7.2 Identities = 22/61 (36%), Positives = 29/61 (47%) Frame = +1 Query: 139 GLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALA 318 GL DENG+ G++G+E G+ D R KK+ L+L G G A A A Sbjct: 109 GLSSDENGIRENGTGGVLGEEGL-PLNGVEAD--RPKKV----LILMSDTGGGHRASAEA 161 Query: 319 I 321 I Sbjct: 162 I 162 >At4g31780.1 68417.m04509 1,2-diacylglycerol 3-beta-galactosyltransferase, putative / monogalactosyldiacylglycerol synthase, putative / MGDG synthase, putative similar to MGD synthase type A from Arabidopsis thaliana [gi:9927297], similar to monogalactosyldiacylglycerol synthase, Cucumis sativus, PID:g1805254 Length = 504 Score = 26.2 bits (55), Expect = 7.2 Identities = 22/61 (36%), Positives = 29/61 (47%) Frame = +1 Query: 139 GLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMARRALLLAGPPGTGKTAIALA 318 GL DENG+ G++G+E G+ D R KK+ L+L G G A A A Sbjct: 109 GLSSDENGIRENGTGGVLGEEGL-PLNGVEAD--RPKKV----LILMSDTGGGHRASAEA 161 Query: 319 I 321 I Sbjct: 162 I 162 >At4g14770.1 68417.m02272 tesmin/TSO1-like CXC domain-containing protein similar to CXC domain containing TSO1-like protein 1 (SOL1) [Arabidopsis thaliana] GI:7767427, CXC domain protein TSO1 [Arabidopsis thaliana] GI:7767425; contains Pfam profile PF03638: Tesmin/TSO1-like CXC domain Length = 658 Score = 26.2 bits (55), Expect = 7.2 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -1 Query: 288 RRPCQE*SSPGHFLTSYHIDNYPCSLTCRLLTHETGCHLN 169 RR C + PG+ TS + C + R + G HLN Sbjct: 261 RRRCLDFEMPGNKQTSSENNTAACESSSRCVVPSIGLHLN 300 >At5g40910.1 68418.m04967 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Non-consensus TT donor splice site at exon 1 Length = 1104 Score = 25.8 bits (54), Expect = 9.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 280 GPPGTGKTAIALAIAQELGT 339 GP G GKT IA A+ +L T Sbjct: 213 GPAGIGKTTIARALFNQLST 232 >At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 25.8 bits (54), Expect = 9.6 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -3 Query: 295 QYQEALPRVKLAGPFSY 245 +Y+E +P++KLAGP S+ Sbjct: 210 RYKEIVPQLKLAGPTSF 226 >At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 25.8 bits (54), Expect = 9.6 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -3 Query: 295 QYQEALPRVKLAGPFSY 245 +Y+E +P++KLAGP S+ Sbjct: 210 RYKEIVPQLKLAGPTSF 226 >At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 25.8 bits (54), Expect = 9.6 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -3 Query: 295 QYQEALPRVKLAGPFSY 245 +Y+E +P++KLAGP S+ Sbjct: 210 RYKEIVPQLKLAGPTSF 226 >At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 25.8 bits (54), Expect = 9.6 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -3 Query: 295 QYQEALPRVKLAGPFSY 245 +Y+E +P++KLAGP S+ Sbjct: 210 RYKEIVPQLKLAGPTSF 226 >At4g14790.1 68417.m02274 ATP-dependent RNA helicase, mitochondrial (SUV3) identical to mitochondrial RNA helicase [Arabidopsis thaliana] GI:5823579; contains Pfam profile PF00271: Helicase conserved C-terminal domain Length = 571 Score = 25.8 bits (54), Expect = 9.6 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 244 SKKMARRALLLAGPPGTGKTAIALAIAQELGTKGPFC 354 ++K R+ +L GP +GKT AL ++ + G +C Sbjct: 84 ARKKKRKVILHVGPTNSGKTYSALKHLEQ-SSSGVYC 119 >At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 489 Score = 25.8 bits (54), Expect = 9.6 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -3 Query: 295 QYQEALPRVKLAGPFSY 245 +Y+E +P++KLAGP S+ Sbjct: 244 RYREIVPQLKLAGPTSF 260 >At2g19490.1 68415.m02278 recA family protein contains Pfam profile: PF00154 recA bacterial DNA recombination protein Length = 430 Score = 25.8 bits (54), Expect = 9.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 262 RALLLAGPPGTGKTAIALAIAQELGTKGPFC 354 R + + GP +GKT +AL + E +G C Sbjct: 113 RVVEIYGPEASGKTTLALHVIAEAQKQGGTC 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.134 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,178,824 Number of Sequences: 28952 Number of extensions: 159412 Number of successful extensions: 731 Number of sequences better than 10.0: 185 Number of HSP's better than 10.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 517767328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -