BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0144 (592 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 25 2.4 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 5.6 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 7.4 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 9.8 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 23 9.8 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 24.6 bits (51), Expect = 2.4 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 158 YAQHRGPLHHEEAFRYYASVYVPHGVSGGRDQHC 259 YA H P H E +Y + P V+ RD +C Sbjct: 404 YAMHHDPAHFPEPEQYRPERFSPDEVA-RRDPYC 436 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 5.6 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -1 Query: 403 SLDQRRGIVRKFGSINCESLVEMGMVQKPW 314 S+D +GI+R G+++ E E + + W Sbjct: 1109 SIDPEKGILRVAGALDREETAEYMLAVEAW 1138 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.0 bits (47), Expect = 7.4 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = -2 Query: 510 QRSFRRSPRCPVPHAAP*SAGQWRPRLKCSQSAHQARWTNEEALCGS 370 QR +R R + HA S + + ++C H+AR + C + Sbjct: 475 QRCYRCLERGHLAHACRSSTDRQQLCIRCGSEGHKARDCSSYVKCAA 521 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 432 LKCSQSAHQARWTNEEALCG 373 ++C Q H+A EE CG Sbjct: 575 IRCGQEGHKAGTCMEEIRCG 594 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 22.6 bits (46), Expect = 9.8 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 433 TRPPLTS*SRRCVRNWTSGRPSKRS 507 +RP LT+ RR R TS PS+RS Sbjct: 15 SRPILTTRGRRWPRPPTSCWPSRRS 39 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 644,621 Number of Sequences: 2352 Number of extensions: 13496 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -