BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0144 (592 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.3 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 3.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 3.9 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 6.8 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 6.8 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 350 VPSRNGYGTETLVSSYGADSHVLTVQEH 267 VP N T T VSS ++ H + EH Sbjct: 1306 VPGNNLIATNTTVSSGSSEDHRRPLSEH 1333 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 490 RPSKRSLSLTMGRRIHFIHDFQTNTTGIIDL 582 R + ++ L M + + IHD T + IDL Sbjct: 309 RETGATVPLHMQKYVQMIHDLHTRISTAIDL 339 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 490 RPSKRSLSLTMGRRIHFIHDFQTNTTGIIDL 582 R + ++ L M + + IHD T + IDL Sbjct: 309 RETGATVPLHMQKYVQMIHDLHTRISTAIDL 339 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 79 PFSRSPVSTLTSLRPLP 129 PF++ P+ L +PLP Sbjct: 66 PFAKPPIGPLRFRKPLP 82 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 79 PFSRSPVSTLTSLRPLP 129 PF++ P+ L +PLP Sbjct: 66 PFAKPPIGPLRFRKPLP 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,283 Number of Sequences: 438 Number of extensions: 3848 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -