BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0141 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 2.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 3.6 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 8.4 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 319 VPWHWCVYSKSNRPYLH 269 +P HW VY + N P LH Sbjct: 33 IPEHWLVYPEPN-PSLH 48 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 604 SWPRVVRAGVSESGFGFVASSCVNAVYWRSV 512 +W GV+ G G VAS +A W+S+ Sbjct: 907 TWSNSQVQGVAVPGSGIVASGQQHAGGWQSI 937 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 8.4 Identities = 17/66 (25%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +3 Query: 492 VEEKLRATDRQ*TAFTHELATKPNPLSDTPALTTRGHDTTSRLVLLQRKTN-SINMIDFT 668 + +K++ T L + + P +T GH + LL N SI +F Sbjct: 117 ISKKIKKTMENKDITKRPLPNESQLIKRHPIVTIMGHVDHGKTTLLDALRNTSIAKSEF- 175 Query: 669 GGRTSC 686 GG T C Sbjct: 176 GGITQC 181 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,946 Number of Sequences: 438 Number of extensions: 3524 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -