BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0137 (670 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: L... 43 0.006 UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-... 38 0.22 UniRef50_Q6AP01 Cluster: Putative uncharacterized protein; n=1; ... 37 0.51 >UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: Like moricin - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 248 Score = 43.2 bits (97), Expect = 0.006 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -3 Query: 248 MGDGNHSPSREPYARLPTRAMTKNVLILGFI 156 MGDGNHSPS PYA LPTRA K + F+ Sbjct: 1 MGDGNHSPSGRPYASLPTRAKMKLTSLFIFV 31 >UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-like protein; n=25; Arthropoda|Rep: Endonuclease and reverse transcriptase-like protein - Bombyx mori (Silk moth) Length = 986 Score = 37.9 bits (84), Expect = 0.22 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 297 LAVEQRLGSAPGIAEVHGRR 238 L+ QRLGSAPGIAEVHGRR Sbjct: 967 LSGRQRLGSAPGIAEVHGRR 986 >UniRef50_Q6AP01 Cluster: Putative uncharacterized protein; n=1; Desulfotalea psychrophila|Rep: Putative uncharacterized protein - Desulfotalea psychrophila Length = 116 Score = 36.7 bits (81), Expect = 0.51 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 5/80 (6%) Frame = +2 Query: 389 CTFSNSIRHILIHCN----RSLALQKHGDKTDPYSRYPISLPQKHMTINPLNDKSAYHY- 553 C +++RH+ HC R + +K +K D + I L +T DK Y Sbjct: 7 CDERSNLRHLGRHCQCSSGRMTSFEKRREKMDNPFKCSICLKTAKITTPRATDKIQYKIE 66 Query: 554 A*TVSVYNVSTNCKEKKFTR 613 T Y VST C+EK FT+ Sbjct: 67 CPTCGCYFVSTTCREKFFTK 86 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 638,895,672 Number of Sequences: 1657284 Number of extensions: 12050289 Number of successful extensions: 21532 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21088 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21526 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51239674196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -