BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0137 (670 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0105 + 756998-757225,757311-758597 29 2.5 07_03_1387 + 26202975-26203274,26203363-26203449,26203541-262036... 28 7.7 >08_01_0105 + 756998-757225,757311-758597 Length = 504 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 7/59 (11%) Frame = -1 Query: 640 FRKTDPGLGAR------ELFFFTIRRYVVYADGLGIMVC*FIVQWIDCH-VFLWE*NWI 485 FR+ DP AR ++F F R Y+D L VC F + H LW +W+ Sbjct: 196 FRRADPAYSARLLHAATQVFDFADRHRGSYSDSLASSVCPFYCSYSGYHDELLWGASWL 254 >07_03_1387 + 26202975-26203274,26203363-26203449,26203541-26203648, 26203708-26203980,26205242-26205355,26205900-26206268 Length = 416 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 233 GYRRPWTSAMPGAEPSRCSTA 295 G RPWT+A G RCS A Sbjct: 17 GGHRPWTAASRGVSARRCSVA 37 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,583,356 Number of Sequences: 37544 Number of extensions: 313923 Number of successful extensions: 559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -