BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0136 (484 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 28 4.6 SB_56750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 >SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 583 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 284 PLLNR*SLSKAFFLSYTYILCLTDPI*IKSFESIKQYAPFLI 409 P L+ ++ KA FL+Y L+ + KS + Y+PFLI Sbjct: 298 PFLSHDAIYKALFLAYPCSPFLSHDVIYKSLFLSRAYSPFLI 339 >SB_56750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 155 SFIKPKIKTFFVIALVGRRAYGSRD-GEWLPSPM 253 S+IK ++K FVI + + YG D GEW+ M Sbjct: 58 SWIKLELKRKFVITGIATQGYGDPDVGEWVKQYM 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,948,481 Number of Sequences: 59808 Number of extensions: 234984 Number of successful extensions: 422 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1013948003 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -