BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0134 (725 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 3.2 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 24 4.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 5.5 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 536 AEGSADSAAIIPQHGEEDRLGSYCKKR 616 AEG P+HG E R ++ +KR Sbjct: 497 AEGGGTLGVQSPRHGHESRANNFRRKR 523 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 24.2 bits (50), Expect = 4.2 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 422 KSADIKVEE-PAAQPEDSKTEVQATVAEISKEEKPSATDAEGSADSAAIIPQHG 580 ++ADI+ EE P A + S E++ ++ ++ P +A AAI+ G Sbjct: 397 EAADIEGEEQPGAVADVSDDELKLIARRMANKKAPGLDGIPNAAVKAAILEHTG 450 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 5/32 (15%) Frame = +3 Query: 516 KNLVLLMQKVL-----LTQLPSFPNMVKKIDL 596 KN+ +++Q+V+ L +LPSFP ++DL Sbjct: 2143 KNVDMVVQRVVFLHEELMKLPSFPRKALEVDL 2174 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,945 Number of Sequences: 2352 Number of extensions: 8167 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -