BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0128 (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_15850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_17593| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_6974| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_17994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_31231| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_15078| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) 29 2.4 SB_39963| Best HMM Match : EGF (HMM E-Value=1.4e-13) 29 3.2 SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_20649| Best HMM Match : SpoIIP (HMM E-Value=1.3) 29 3.2 SB_51880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_51100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_36986| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_39606| Best HMM Match : DUF164 (HMM E-Value=0.47) 29 4.2 SB_4002| Best HMM Match : Galactosyl_T (HMM E-Value=3.1e-24) 29 4.2 SB_51787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_47093| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_33335| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_28413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_25522| Best HMM Match : Saccharop_dh_N (HMM E-Value=3.9) 28 5.6 SB_17583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_58849| Best HMM Match : zf-piccolo (HMM E-Value=2.8) 28 5.6 SB_57839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_44560| Best HMM Match : DUF1086 (HMM E-Value=1.2) 28 5.6 SB_56667| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) 28 7.4 SB_20527| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) 28 7.4 SB_13523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_37768| Best HMM Match : SpoVG (HMM E-Value=7.9) 28 7.4 SB_37548| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_30130| Best HMM Match : Cadherin (HMM E-Value=0.0035) 28 7.4 SB_12501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_5169| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 27 9.8 SB_30536| Best HMM Match : fn3 (HMM E-Value=0.079) 27 9.8 SB_30266| Best HMM Match : Fzo_mitofusin (HMM E-Value=1.2) 27 9.8 >SB_18297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 32.7 bits (71), Expect = 0.26 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 2/86 (2%) Frame = +1 Query: 148 KAKQNGRRLQNVDRRVSSHHQRETERISHQMVRRGHNLHPLG--VCRRHRQG*FLPQRVD 321 + K +G R+++ + RV SH R +++ G+ + G V + RV Sbjct: 41 RVKSHGNRVKSHENRVKSHENRVKSH-GNRVKSHGNRVKSHGNRVKSHENRVKSHGNRVK 99 Query: 322 SHQNLRPEFEQRVEARPVRIKEHPKK 399 SH+N E RV++ R+K H + Sbjct: 100 SHENRVKSHENRVKSHENRVKSHENR 125 Score = 30.3 bits (65), Expect = 1.4 Identities = 23/81 (28%), Positives = 35/81 (43%) Frame = +1 Query: 148 KAKQNGRRLQNVDRRVSSHHQRETERISHQMVRRGHNLHPLGVCRRHRQG*FLPQRVDSH 327 + K +G R+++ RV SH R SH+ + H R + RV SH Sbjct: 62 RVKSHGNRVKSHGNRVKSHGNRVK---SHENRVKSHGNRVKSHENRVKSH---ENRVKSH 115 Query: 328 QNLRPEFEQRVEARPVRIKEH 390 +N E RV++ R+K H Sbjct: 116 ENRVKSHENRVKSHGNRVKSH 136 >SB_15850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/45 (37%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRL-TFRSNEFFYNEIS-FYEKVLPE 478 N+ES H + K+IP N+++RL T S++ +N+ + Y+K L E Sbjct: 73 NRESNHPPTITKNIPVNINKRLSTLSSDKETFNQAAPPYQKALDE 117 >SB_17593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 606 GNHISIRLPKQMTSWTPSTYENNNFGHLSNGSLALFEARNFDSSG 472 GN + ++ P+ S TPS N+ GH N ++ +RN SSG Sbjct: 127 GNDLDVKFPQSRYSRTPSPIPGNSSGHSKNTTI---RSRNGVSSG 168 >SB_6974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F S Y+K L E Sbjct: 4 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQAASPYQKALDE 48 >SB_17994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRL-TFRSNEFFYNEIS-FYEKVLPE 478 ++ES H + K+IP ++S+RL T S++ +N+ + Y+K L E Sbjct: 258 HRESNHPPTITKNIPASISKRLSTLSSDKETFNQAAPPYQKALDE 302 >SB_31231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSNE--FFYNEISFYEKVLPE 478 ++ES H + K+IP ++RRL+ S++ FF Y+K L + Sbjct: 101 HRESNHPPSITKNIPAGINRRLSALSSDQAFFDQTAPPYQKALDD 145 >SB_15078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 569 RHGPRRRMRITISGICRTVH 510 RH PR R + T SG+C T+H Sbjct: 538 RHTPRTRPKFTASGVCITLH 557 >SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) Length = 1217 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H V K+IP ++++RL+ S+ E F + Y+K L E Sbjct: 942 HRESNHPPTVTKNIPASINKRLSTLSSDKETFEHAAPPYQKALDE 986 >SB_39963| Best HMM Match : EGF (HMM E-Value=1.4e-13) Length = 3035 Score = 29.1 bits (62), Expect = 3.2 Identities = 20/89 (22%), Positives = 41/89 (46%) Frame = +2 Query: 206 TNERLNESLTKWFGEDTTFTHWEYVGDTGKGDSYLSELIRIKIYGLNSNKESKHVQCVLK 385 T + E+L+K E F+HW + T + + +++ + + S+KE+ H L Sbjct: 187 TGDECQETLSKSAMEMDAFSHWYFAKKTKWRLTEILQILGTRGFEYISHKETTHRGVPLW 246 Query: 386 SIPKNVSRRLTFRSNEFFYNEISFYEKVL 472 + V +FR++ F++ Y V+ Sbjct: 247 VVQAKVGCGRSFRADPRFHSCREKYTAVM 275 >SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3172 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 417 RSAAMSSSITRSVSTRKSYLNYQSSEPQKAPMNRSTNARNCYSHTSTGSMT 569 R+A + S RS RK+YL Y+S+ + + R AR + ++T Sbjct: 2388 RAARLIQSYYRSCVARKAYLRYRSACVRMQALVRGKQAREAFMELKMATVT 2438 Score = 27.5 bits (58), Expect = 9.8 Identities = 22/72 (30%), Positives = 34/72 (47%) Frame = +1 Query: 76 IRCLLILKRYLITENFLNIIQILFKAKQNGRRLQNVDRRVSSHHQRETERISHQMVRRGH 255 +R LL KR+L + I+Q ++A +GRR + + +H+ I+ Q RG Sbjct: 2012 VRALLARKRFLEMKTATLILQKRYRALNHGRRER------AEYHRARAAVITIQAYIRGT 2065 Query: 256 NLHPLGVCRRHR 291 L RRHR Sbjct: 2066 QARDL--ARRHR 2075 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRL-TFRSNEFFYNEIS-FYEKVLPE 478 ++ES H + K+IP ++++RL T S++ +N+ + Y+K L E Sbjct: 1283 HRESNHPPTITKNIPASINKRLSTLSSDKETFNQAAPPYQKALDE 1327 >SB_20649| Best HMM Match : SpoIIP (HMM E-Value=1.3) Length = 466 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRL-TFRSNEFFYNEIS-FYEKVLPE 478 ++ES H + K+IP ++++RL T S++ +N+ + Y+K L E Sbjct: 389 HRESNHPPTITKNIPASINKRLSTLSSDKETFNQAAPPYQKALDE 433 >SB_51880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRL-TFRSNEFFYNEIS-FYEKVLPE 478 ++ES H + K+IP ++++RL T S+E +++ + Y+K L E Sbjct: 50 HRESNHQPTITKNIPASINKRLSTLSSDEETFDQAAPPYQKALDE 94 >SB_51100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRL-TFRSNEFFYNEIS-FYEKVLPE 478 ++ES H + K+IP ++++RL T S+E +++ + Y+K L E Sbjct: 55 HRESNHQPTITKNIPASINKRLSTLSSDEETFDQAAPPYQKALDE 99 >SB_36986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 337 HRESNHPSTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 381 >SB_39606| Best HMM Match : DUF164 (HMM E-Value=0.47) Length = 626 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 3/63 (4%) Frame = +3 Query: 426 AMSSSITRSVSTRKSYLNYQSSEPQKAPMNRSTNARNCYSHTSTGSM---TSFVWEDESI 596 ++S + T SYL Y SS P+N S + +W+++ I Sbjct: 539 SLSGGVRPEADTSGSYLQYPSSVGMTRPVNGYNPYTTAVSQAPDNDLIWDNDLIWDNDLI 598 Query: 597 YDY 605 +DY Sbjct: 599 WDY 601 >SB_4002| Best HMM Match : Galactosyl_T (HMM E-Value=3.1e-24) Length = 683 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/52 (25%), Positives = 28/52 (53%) Frame = +2 Query: 380 LKSIPKNVSRRLTFRSNEFFYNEISFYEKVLPELSKFRASKSANEPFDKCPK 535 + S+PK + TF+ N+ +NE+ + + +++ A K + E +D+ K Sbjct: 578 MPSVPK--FHQATFQPNKMTFNELGQFRSEMKNMTQKLAEKRSKEDYDRTVK 627 >SB_51787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 81 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 125 >SB_47093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 153 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQATPPYQKALDE 197 >SB_33335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 48 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 92 >SB_28413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 101 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 145 >SB_25522| Best HMM Match : Saccharop_dh_N (HMM E-Value=3.9) Length = 285 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 153 HRESSHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 197 >SB_17583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 55 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 99 >SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 756 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 177 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 221 >SB_58849| Best HMM Match : zf-piccolo (HMM E-Value=2.8) Length = 243 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 172 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 216 >SB_57839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 48 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 92 >SB_44560| Best HMM Match : DUF1086 (HMM E-Value=1.2) Length = 918 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 181 HRESNHQPTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 225 >SB_56667| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) Length = 628 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSNE 433 ++ES H ++K+IP ++RRL+ S++ Sbjct: 334 HRESNHPPSIIKNIPAGINRRLSALSSD 361 >SB_20527| Best HMM Match : Pepsin-I3 (HMM E-Value=2.2) Length = 671 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSNE 433 ++ES H ++K+IP ++RRL+ S++ Sbjct: 420 HRESNHPPSIIKNIPAGINRRLSALSSD 447 >SB_13523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRS--NEFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S E F Y+K L E Sbjct: 68 HRESNHPTTITKNIPASINKRLSTLSADKETFDQAAPPYQKALDE 112 >SB_37768| Best HMM Match : SpoVG (HMM E-Value=7.9) Length = 163 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 101 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYKKALDE 145 >SB_37548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 101 HRESNHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYKKALDE 145 >SB_30130| Best HMM Match : Cadherin (HMM E-Value=0.0035) Length = 391 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 ++ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 77 HRESNHPLTITKNIPTSINKRLSTLSSDKETFDQATPPYQKALDE 121 >SB_12501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 173 FKTLTGVSPLITNERLNESLTKWFGEDTTFTHWEYVGDTGKG 298 F L+ P+ + RL+ESL + FG T H + + G G Sbjct: 65 FSQLSTSRPIASISRLHESLKRSFGRPTGLDHDNIITNMGGG 106 >SB_5169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 345 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +2 Query: 353 KESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVLPE 478 +ES H + K+IP ++++RL+ S+ E F Y+K L E Sbjct: 62 RESNHPPTITKNIPASINKRLSTLSSDKETFDQAAPPYQKALDE 105 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +2 Query: 350 NKESKHVQCVLKSIPKNVSRRLTFRSN--EFFYNEISFYEKVL 472 ++ES H + K+IP ++++RL+ S+ E F Y+K L Sbjct: 1146 HRESNHPPTITKNIPASINKRLSTLSSDKEIFDQAAPPYQKAL 1188 >SB_30536| Best HMM Match : fn3 (HMM E-Value=0.079) Length = 754 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 124 LNIIQILFKAKQNGRRLQNVDRRVSSHHQRETERISHQMVRRGHNLHPLG 273 +N Q+ F + G+ L N D R S+ +Q + ++H + R HP+G Sbjct: 307 VNGYQVFFDDRPLGKAL-NADTR-SADYQLSSSPVTHVITARSLTCHPIG 354 >SB_30266| Best HMM Match : Fzo_mitofusin (HMM E-Value=1.2) Length = 1052 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = +3 Query: 441 ITRSVSTRKSYLNYQSSEPQKAPMNRSTNARNCYSHTSTGSMTSFVWEDESIYDYR 608 + R ++T SY+ Q+ + A M S +++ G +F +DE++ YR Sbjct: 488 LNRKLNTTDSYMPQQAYDEADASMESSLTLPTDALNSTPGPHLAFTEDDETVPTYR 543 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,511,334 Number of Sequences: 59808 Number of extensions: 371267 Number of successful extensions: 1219 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1209 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -