BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0128 (642 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.27 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 5.8 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 5.8 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 7.7 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 26.2 bits (55), Expect = 0.27 Identities = 17/76 (22%), Positives = 33/76 (43%) Frame = +1 Query: 166 RRLQNVDRRVSSHHQRETERISHQMVRRGHNLHPLGVCRRHRQG*FLPQRVDSHQNLRPE 345 RRL + D+R+S + + HQ + + HP Q PQ+ Q +P+ Sbjct: 789 RRLMSEDKRLSKSVNGDQSQPPHQQLHHHQSTHP------QAQAQAQPQQQQQQQQQQPQ 842 Query: 346 FEQRVEARPVRIKEHP 393 +Q+ + + + + P Sbjct: 843 QQQQQQQQQQQQQRGP 858 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 624 LSDGTAGNHISIRLPKQMTSWTPS 553 +SD T N I +PK+M W P+ Sbjct: 378 ISDYTF-NDTKITIPKEMKIWIPA 400 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 5.8 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 9/95 (9%) Frame = +2 Query: 230 LTKWFGEDTTFTHWEYVGDTGKGDSYLSELIRIKIYGLNSNKESKHVQCVLKSIPK--NV 403 L KW D + WE + + L E R ++ L S K + + I K N Sbjct: 262 LIKWKNWDLKYNTWEPISNLINCSDILEEFERNRLQLLESFKRKVNFYPNNQDIEKFLNY 321 Query: 404 SRR-------LTFRSNEFFYNEISFYEKVLPELSK 487 +R ++ SN F N + F ++ + SK Sbjct: 322 LKRGGKTLTSISVESNTMFINILKFLKQKYVKNSK 356 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 302 SYLSELIRIKIYGLNSN 352 +YLS RI Y +NSN Sbjct: 445 AYLSRSERINYYNVNSN 461 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,133 Number of Sequences: 438 Number of extensions: 3566 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -