BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0127 (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 36 9e-04 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 33 0.005 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 33 0.008 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 32 0.011 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 32 0.015 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 32 0.015 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 30 0.045 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 30 0.045 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 29 0.14 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 28 0.18 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 28 0.18 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 27 0.42 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 25 1.7 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 25 2.2 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 25 2.2 AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. 23 5.1 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 6.8 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 6.8 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 23 9.0 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 35.9 bits (79), Expect = 9e-04 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +3 Query: 282 CTRCLAFGHGRKFCTESVDRCSHCGGPH 365 C RC GH K CT S +C CGGPH Sbjct: 685 CIRCGVVGHMAKVCT-SQPKCLKCGGPH 711 Score = 31.5 bits (68), Expect = 0.019 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 6/67 (8%) Frame = +3 Query: 240 LQRIRVEDQSPL--IQCTRCLAFGHGRKFCTESVDR---CSHCG-GPHLREKCADFIAGT 401 + ++R +P ++C RCL GH C DR C CG H+ + C + Sbjct: 646 VSKVRAAPPTPRERVRCYRCLELGHWAHDCRSPDDRQNMCIRCGVVGHMAKVCT-----S 700 Query: 402 EPQCCNC 422 +P+C C Sbjct: 701 QPKCLKC 707 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 33.5 bits (73), Expect = 0.005 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 282 CTRCLAFGHGRKFCTESVDRCSHCGGPH 365 C RC + GH + C+ V +C+ CGGPH Sbjct: 500 CIRCGSEGHKARDCSSYV-KCAACGGPH 526 Score = 32.3 bits (70), Expect = 0.011 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 6/57 (10%) Frame = +3 Query: 240 LQRIR-VEDQSPLIQ-CTRCLAFGHGRKFCTESVDR---CSHCGGP-HLREKCADFI 392 + +IR VE +P Q C RCL GH C S DR C CG H C+ ++ Sbjct: 461 ISKIRGVEKAAPERQRCYRCLERGHLAHACRSSTDRQQLCIRCGSEGHKARDCSSYV 517 Score = 23.8 bits (49), Expect = 3.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 362 ASAREMRRLHRRDRTAVLQLLTLWVAEGRP 451 A ++ H+RDR + LL VA G+P Sbjct: 144 AQMEKLAAAHQRDRNLLNSLLAAKVAGGQP 173 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 32.7 bits (71), Expect = 0.008 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = +3 Query: 279 QCTRCLAFGHGRKFCTESVDR---CSHCGGP-HLREKCADFIAGTEPQCCNCS 425 +C RCL GH + C VDR C CG HL + C E +C CS Sbjct: 363 RCYRCLERGHIARECRSPVDRQKACIRCGAEGHLAKDC-----NAEVKCAVCS 410 Score = 24.2 bits (50), Expect = 2.9 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 326 RECGQMQSLWRTASAREMRRLHRRDRTAVLQLL 424 +E + + L +MR H RDRTA+ +LL Sbjct: 37 QEYTERRELIAREEMEKMRAAHERDRTALNKLL 69 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 32.3 bits (70), Expect = 0.011 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Frame = +3 Query: 240 LQRIRVEDQSPL--IQCTRCLAFGHGRKFCTESVDR---CSHCG 356 + R+++ +P ++C RCL GH + C VDR C CG Sbjct: 535 ISRVKMAPPTPKEHLRCYRCLEHGHNARDCRSPVDRQNVCIRCG 578 Score = 31.9 bits (69), Expect = 0.015 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 282 CTRCLAFGHGRKFCTESVDRCSHCGGPHL 368 C RC GH C E + RC C GPH+ Sbjct: 574 CIRCGQEGHKAGTCMEEI-RCGKCDGPHV 601 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 31.9 bits (69), Expect = 0.015 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 282 CTRCLAFGHGRKFCTESVDRCSHCGGPH 365 C RC A H CT V +C CGGPH Sbjct: 258 CIRCGAANHKAVNCTNDV-KCLLCGGPH 284 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 31.9 bits (69), Expect = 0.015 Identities = 21/52 (40%), Positives = 23/52 (44%) Frame = +3 Query: 258 EDQSPLIQCTRCLAFGHGRKFCTESVDRCSHCGGPHLREKCADFIAGTEPQC 413 ED+S L C C A H CT S +C CGGPH A G QC Sbjct: 307 EDRSSL--CLHCGAADHRAASCT-SDPKCIVCGGPH--RIAAPMCKGPPSQC 353 Score = 31.5 bits (68), Expect = 0.019 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 3/64 (4%) Frame = +3 Query: 240 LQRIRVEDQSPLIQCTRCLAFGHGRKFCT--ESVDRCSHCG-GPHLREKCADFIAGTEPQ 410 L R + Q ++C RCL GH C + C HCG H C ++P+ Sbjct: 277 LVRSAPKQQQSAVRCFRCLERGHTTADCAGEDRSSLCLHCGAADHRAASCT-----SDPK 331 Query: 411 CCNC 422 C C Sbjct: 332 CIVC 335 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 30.3 bits (65), Expect = 0.045 Identities = 31/107 (28%), Positives = 43/107 (40%), Gaps = 5/107 (4%) Frame = +3 Query: 51 DEEIIKALHIQNEDIFRDLSQEDKETTIKFKKRTKNPKTAHVIVQ--VGPVVWQRMTEAG 224 DEE IK + + L ++ T+ +R K A V + +V R E G Sbjct: 394 DEEAIK------KALMTTLGKQSLVATVNLWERRDMTKRARVRLPRAEAELVKDRRLELG 447 Query: 225 ALYLDLQRI-RVEDQSPLIQCTRCLAFGHGRKFCT--ESVDRCSHCG 356 Y + +V Q L +C RCL GH CT + RC CG Sbjct: 448 YTYCSVHEAPKVSGQ--LTRCFRCLERGHIAATCTGEDRSKRCLRCG 492 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 30.3 bits (65), Expect = 0.045 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = +3 Query: 279 QCTRCLAFGHGRKFCTESVDR---CSHCGGP-HLREKCADFIAGTEPQCCNCS 425 +C RCL GH + C VDR C CG H + C +E +C C+ Sbjct: 389 RCYRCLERGHLARDCQSPVDRQQACIRCGADGHYAKSCT-----SEIKCAACN 436 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 28.7 bits (61), Expect = 0.14 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 4/70 (5%) Frame = +3 Query: 276 IQCTRCLAFGHGRKFCTESVDR---CSHCG-GPHLREKCADFIAGTEPQCCNCSHSGLRK 443 ++C RCL GH + C V+ C CG HL C E +C +C+ Sbjct: 404 LRCYRCLERGHVSRDCHSPVNHSNVCIRCGTSGHLAATCE-----AEVRCASCA------ 452 Query: 444 ADHNAFSAEC 473 H SA+C Sbjct: 453 GPHRMGSAQC 462 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 28.3 bits (60), Expect = 0.18 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 7/62 (11%) Frame = +3 Query: 192 PVVWQRMTEAGALYLD--LQRIRVEDQSP--LIQCTRCLAFGHGRKFCTESVDR---CSH 350 PV R E L+L + ++R +P +C RCL GH C + DR C Sbjct: 474 PVKSARQLEGLKLFLCDCVSKVRAAPPTPPERQRCFRCLEMGHIASNCRSTADRQNLCIR 533 Query: 351 CG 356 CG Sbjct: 534 CG 535 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 28.3 bits (60), Expect = 0.18 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 252 RVEDQSPLIQCTRCLAFGHGRKFCTESVDRCSHCG 356 R D+S L C +C GH ++ CT SV +C CG Sbjct: 291 REPDRSNL--CWKCGLSGHKKQACTNSV-KCLDCG 322 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 27.1 bits (57), Expect = 0.42 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = +1 Query: 217 RLGPSTWTCKGSESRTSLRSSNARGASHLDMVENFAPRVWTDAVTVEDRICARNAQTSSQ 396 R G S GS R SL+ RGA L VEN P TD++ + ++ + + ++ + Sbjct: 1411 RRGTSATPAGGSFKRRSLKLR--RGAKDLKEVENEYPVRRTDSIQSKRKVSSLSDRSDNS 1468 Query: 397 GPNR 408 P + Sbjct: 1469 EPGQ 1472 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 25.0 bits (52), Expect = 1.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 279 QCTRCLAFGHGRKFCTESVDRCSHC 353 QC RC +GH C DR S C Sbjct: 213 QCYRCYEYGHTAARC-HGKDRSSKC 236 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 24.6 bits (51), Expect = 2.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -2 Query: 431 RV*AVAALRFGPCDEVCAFLAQMRSSTVTASVHTLGAKFST 309 R+ A L G ++ C FL + +S V L A+F+T Sbjct: 150 RMKAAFPLVLGIAEQFCGFLREQYTSDDVVEVRDLMARFTT 190 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 24.6 bits (51), Expect = 2.2 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 256 SRTSLRSSNARGASHLDMVENFAPRVWTDAVTVEDRICAR 375 S L + +LDMV N R WT A + DR C + Sbjct: 368 SADKLNYETLQSMRYLDMVANETLRKWTPAPFL-DRTCTK 406 >AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. Length = 140 Score = 23.4 bits (48), Expect = 5.1 Identities = 22/88 (25%), Positives = 32/88 (36%), Gaps = 1/88 (1%) Frame = +3 Query: 114 EDKETTIKFKKRTKNPKTAHVIVQVGPVVWQRMTEAGALY-LDLQRIRVEDQSPLIQCTR 290 E +T K T T + I Q+ W L + Q + +D S I+C + Sbjct: 52 ESSYSTTATHKNTDG-STDYGIFQINNAYWCDSHYGSNLCNIPCQNLLTDDISEDIKCAK 110 Query: 291 CLAFGHGRKFCTESVDRCSHCGGPHLRE 374 + HG VD C P +RE Sbjct: 111 MVYSHHGFNAWYGWVDHCRGKALPDIRE 138 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 237 PGRGPQPPSSFAIPRDQP 184 P GP PPSS +P + P Sbjct: 355 PLPGPSPPSSLGMPGNIP 372 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.0 bits (47), Expect = 6.8 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +2 Query: 152 KKSQNGARHCPGWSRGMAKDDGGWGPLPGPAKDQSRGPVSAH 277 ++ G + PG G DG +GP+ P + RG H Sbjct: 333 ERGHKGEKGLPG-QPGPRGRDGNFGPVGLPGQKGDRGSEGLH 373 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 106 CLRKIKKRPLSSRRGQKIPKRRTS 177 C R RP+ + RG++ P+ TS Sbjct: 9 CARASPSRPILTTRGRRWPRPPTS 32 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 677,186 Number of Sequences: 2352 Number of extensions: 16967 Number of successful extensions: 47 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -