BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0123 (647 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g14000.2 68416.m01768 expressed protein 28 6.1 At3g14000.1 68416.m01767 expressed protein 28 6.1 At3g13080.4 68416.m01638 ABC transporter family protein almost i... 27 8.1 At3g13080.3 68416.m01637 ABC transporter family protein almost i... 27 8.1 At3g13080.2 68416.m01636 ABC transporter family protein almost i... 27 8.1 At3g13080.1 68416.m01635 ABC transporter family protein almost i... 27 8.1 >At3g14000.2 68416.m01768 expressed protein Length = 374 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +2 Query: 452 VAPSPAQFRYNYT*NGDGTTSPKWVSRRFVHFLAFFLGDAALP 580 VA + +FRY Y G G+++PK + + L FL P Sbjct: 81 VASNSGRFRYAYKRAGSGSSTPKILGKEMESRLKGFLSGEGTP 123 >At3g14000.1 68416.m01767 expressed protein Length = 374 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +2 Query: 452 VAPSPAQFRYNYT*NGDGTTSPKWVSRRFVHFLAFFLGDAALP 580 VA + +FRY Y G G+++PK + + L FL P Sbjct: 81 VASNSGRFRYAYKRAGSGSSTPKILGKEMESRLKGFLSGEGTP 123 >At3g13080.4 68416.m01638 ABC transporter family protein almost identical to MRP-like ABC transporter GI:2316016 from [Arabidopsis thaliana]; contains Pfam profile: PF00005 ABC transporter Length = 1120 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -2 Query: 634 NEEGEPQGQKSENVE*CQRQSCIAQEECQEMNKPPGDPFWASRTVAILGIII 479 +E+ E Q K++ +E + Q I QEE +E D +W T+A G ++ Sbjct: 899 DEKLESQDLKNDKLESVEPQRQIIQEEEREKGSVALDVYWKYITLAYGGALV 950 >At3g13080.3 68416.m01637 ABC transporter family protein almost identical to MRP-like ABC transporter GI:2316016 from [Arabidopsis thaliana]; contains Pfam profile: PF00005 ABC transporter Length = 1120 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -2 Query: 634 NEEGEPQGQKSENVE*CQRQSCIAQEECQEMNKPPGDPFWASRTVAILGIII 479 +E+ E Q K++ +E + Q I QEE +E D +W T+A G ++ Sbjct: 899 DEKLESQDLKNDKLESVEPQRQIIQEEEREKGSVALDVYWKYITLAYGGALV 950 >At3g13080.2 68416.m01636 ABC transporter family protein almost identical to MRP-like ABC transporter GI:2316016 from [Arabidopsis thaliana]; contains Pfam profile: PF00005 ABC transporter Length = 1489 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -2 Query: 634 NEEGEPQGQKSENVE*CQRQSCIAQEECQEMNKPPGDPFWASRTVAILGIII 479 +E+ E Q K++ +E + Q I QEE +E D +W T+A G ++ Sbjct: 899 DEKLESQDLKNDKLESVEPQRQIIQEEEREKGSVALDVYWKYITLAYGGALV 950 >At3g13080.1 68416.m01635 ABC transporter family protein almost identical to MRP-like ABC transporter GI:2316016 from [Arabidopsis thaliana]; contains Pfam profile: PF00005 ABC transporter Length = 1514 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -2 Query: 634 NEEGEPQGQKSENVE*CQRQSCIAQEECQEMNKPPGDPFWASRTVAILGIII 479 +E+ E Q K++ +E + Q I QEE +E D +W T+A G ++ Sbjct: 899 DEKLESQDLKNDKLESVEPQRQIIQEEEREKGSVALDVYWKYITLAYGGALV 950 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,502,037 Number of Sequences: 28952 Number of extensions: 231839 Number of successful extensions: 495 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -