BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0122 (321 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 21 8.6 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 21 8.6 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/38 (21%), Positives = 19/38 (50%) Frame = +1 Query: 43 CLLTNTNILFLVNMNYLLTFPNLKVVNALAYFISCNNI 156 C++ +V M LL ++ ++A+ + CN++ Sbjct: 157 CMMNEIKTSPVVEMKDLLARFTTDIIGSVAFGLECNSL 194 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +3 Query: 255 RVIRQRRDSRGGPVPNSP 308 R++ + S GGP N P Sbjct: 226 RILASKTSSSGGPARNGP 243 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 302,254 Number of Sequences: 2352 Number of extensions: 4140 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 21613350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -