BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0122 (321 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011431-1|AAR99089.1| 1120|Drosophila melanogaster RH64806p pro... 28 3.1 BT021312-1|AAX33460.1| 1215|Drosophila melanogaster RE14947p pro... 27 5.4 AE014134-2679|AAN10933.1| 1170|Drosophila melanogaster CG12455-P... 27 5.4 AE014134-2678|AAF53505.2| 2190|Drosophila melanogaster CG12455-P... 27 5.4 AJ507731-1|CAD45644.1| 157|Drosophila melanogaster thioredoxinT... 27 7.1 AE014298-718|AAF46018.2| 157|Drosophila melanogaster CG3315-PA ... 27 7.1 BT011435-1|AAR99093.1| 103|Drosophila melanogaster RH18724p pro... 26 9.4 AY566036-1|AAS75046.1| 288|Drosophila melanogaster 5-HT2 protein. 26 9.4 AE014297-4296|AAN14306.1| 103|Drosophila melanogaster CG31047-P... 26 9.4 AE014296-1219|AAF50588.3| 1120|Drosophila melanogaster CG32381-P... 26 9.4 >BT011431-1|AAR99089.1| 1120|Drosophila melanogaster RH64806p protein. Length = 1120 Score = 27.9 bits (59), Expect = 3.1 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +3 Query: 219 SISLIFYLPDIGRVIRQRRDSRGGPVP 299 S L F + GR R+RRDS GGPVP Sbjct: 168 SFRLSFKRREAGR--RERRDSLGGPVP 192 >BT021312-1|AAX33460.1| 1215|Drosophila melanogaster RE14947p protein. Length = 1215 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 219 SISLIFYLPDIGRVIRQRRDSRGGPVPNSPYS 314 SIS+ F+ + RV +++D P+PN+P++ Sbjct: 632 SISVKFHYDKMRRVSEEKQDYFFAPLPNTPFT 663 >AE014134-2679|AAN10933.1| 1170|Drosophila melanogaster CG12455-PB, isoform B protein. Length = 1170 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 219 SISLIFYLPDIGRVIRQRRDSRGGPVPNSPYS 314 SIS+ F+ + RV +++D P+PN+P++ Sbjct: 587 SISVKFHYDKMRRVSEEKQDYFFAPLPNTPFT 618 >AE014134-2678|AAF53505.2| 2190|Drosophila melanogaster CG12455-PA, isoform A protein. Length = 2190 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 219 SISLIFYLPDIGRVIRQRRDSRGGPVPNSPYS 314 SIS+ F+ + RV +++D P+PN+P++ Sbjct: 594 SISVKFHYDKMRRVSEEKQDYFFAPLPNTPFT 625 >AJ507731-1|CAD45644.1| 157|Drosophila melanogaster thioredoxinT protein. Length = 157 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 55 NTNILFLVNMNYLLTFPNLKVVNALAYFISCNNIIL*KYLQ 177 N +I N+N + TF +K N L F+ CN+ L K ++ Sbjct: 63 NEDITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLME 103 >AE014298-718|AAF46018.2| 157|Drosophila melanogaster CG3315-PA protein. Length = 157 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 55 NTNILFLVNMNYLLTFPNLKVVNALAYFISCNNIIL*KYLQ 177 N +I N+N + TF +K N L F+ CN+ L K ++ Sbjct: 63 NEDITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLME 103 >BT011435-1|AAR99093.1| 103|Drosophila melanogaster RH18724p protein. Length = 103 Score = 26.2 bits (55), Expect = 9.4 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +1 Query: 64 ILFLVNMNYLLTFPNL--KVVNALAYFISCNNIIL*KYLQIFLQ 189 I +L N+ Y + F L + L YF++CN+ + +L + LQ Sbjct: 5 IQYLSNLYYPMHFLKLILGIQKILVYFLACNSKVFNDFLPVQLQ 48 >AY566036-1|AAS75046.1| 288|Drosophila melanogaster 5-HT2 protein. Length = 288 Score = 26.2 bits (55), Expect = 9.4 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 52 TNTNILFLVNMNYLLTFPNLKVVNALAYFI 141 ++ +L LVN ++ PN+ V+N A+F+ Sbjct: 69 SSITVLGLVNEKNIMPXPNICVINNXAFFV 98 >AE014297-4296|AAN14306.1| 103|Drosophila melanogaster CG31047-PA protein. Length = 103 Score = 26.2 bits (55), Expect = 9.4 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +1 Query: 64 ILFLVNMNYLLTFPNL--KVVNALAYFISCNNIIL*KYLQIFLQ 189 I +L N+ Y + F L + L YF++CN+ + +L + LQ Sbjct: 5 IQYLSNLYYPMHFLKLILGIQKILVYFLACNSKVFNDFLPVQLQ 48 >AE014296-1219|AAF50588.3| 1120|Drosophila melanogaster CG32381-PA protein. Length = 1120 Score = 26.2 bits (55), Expect = 9.4 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 219 SISLIFYLPDIGRVIRQRRDSRGGPVP 299 S L F + GR R++RDS GGPVP Sbjct: 168 SFRLSFKRREAGR--REQRDSLGGPVP 192 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,675,947 Number of Sequences: 53049 Number of extensions: 180423 Number of successful extensions: 430 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 674007744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -