BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0121 (566 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1731 - 29102403-29102720,29103529-29103735,29103937-291052... 28 4.5 >07_03_1731 - 29102403-29102720,29103529-29103735,29103937-29105210, 29105298-29105734,29106370-29106764,29106921-29107051, 29109034-29109052 Length = 926 Score = 28.3 bits (60), Expect = 4.5 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 7/56 (12%) Frame = -3 Query: 510 VSLSHMVSELKLNDKKLLPLFEWSQLNCSSIKNTS----NC*YK---DKTHKNKFL 364 V S+ V+ L++ +KKL+ E + NC +++N+S +C K +K H KFL Sbjct: 482 VDASNKVACLEMGNKKLIDELEKVRNNCDNLQNSSVELHDCFTKAVEEKDHLRKFL 537 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,255,623 Number of Sequences: 37544 Number of extensions: 263107 Number of successful extensions: 477 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1305140760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -