BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0121 (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51629| Best HMM Match : NUMOD3 (HMM E-Value=9.8) 28 6.1 SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) 28 6.1 >SB_51629| Best HMM Match : NUMOD3 (HMM E-Value=9.8) Length = 337 Score = 27.9 bits (59), Expect = 6.1 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = +3 Query: 126 IKGIVYTTPMTPLSFTILSV**INLEEYVFRPPE*RIVVLYRTKNYNNNCE 278 +KGI T PMTP FT + + +FR R+ KN N E Sbjct: 161 MKGIDPTRPMTPKEFTYRTAELVKHSNEMFRTQRSRVKTKGLPKNSEENAE 211 >SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) Length = 679 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 Query: 204 PRGLFTKHSVL*TIKASSVLY 142 PRGLFTKH L KA+ LY Sbjct: 27 PRGLFTKHRSLKKFKATVELY 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,804,695 Number of Sequences: 59808 Number of extensions: 321628 Number of successful extensions: 1283 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1283 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -