Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0121
         (566 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB046863-1|BAB13469.1|  993|Homo sapiens KIAA1643 protein protein.     30   6.5  

>AB046863-1|BAB13469.1|  993|Homo sapiens KIAA1643 protein protein.
          Length = 993

 Score = 29.9 bits (64), Expect = 6.5
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = -3

Query: 300 TQSTSLIIHSCYCNFLCGTKRQFFIQGV-EKHTPRGL 193
           T +T+ ++HSC C   CG  R+  ++ + EK +P G+
Sbjct: 660 TGATNCLLHSCVCCGSCGDSREDVVERLREKCSPGGV 696


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,684,891
Number of Sequences: 237096
Number of extensions: 1509248
Number of successful extensions: 2579
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2393
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2579
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5759818212
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)