BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0120 (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 3.6 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 6.3 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 8.3 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 8.3 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 210 AICHDITRKQCQVNKHR*IY 151 A+CH + R +N H+ IY Sbjct: 405 ALCHKVFRTLNSLNNHKSIY 424 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 360 PRGSALPGRLTPRS*FDSSVYKMSRIRR 277 PRG +LP +TP + + ++IRR Sbjct: 151 PRGGSLPTPVTPTPTTVQQLLRRAQIRR 178 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +1 Query: 223 KYAWGDALESSDCPGPDGSPYPRHLINRAIKSGPWSQSSRQ 345 KY G+ SSD + S R +K P +QS+++ Sbjct: 302 KYGSGECYFSSDLSESETSSDEEEADTRPLKKEPITQSNKR 342 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +2 Query: 164 CLFTWHCLRVMSWQIAVHG*NMHGEMPW 247 C + + +++W I +M E+PW Sbjct: 71 CWMNVYYIVILAWAIFYFFMSMRSELPW 98 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 343 QGRAARTLDPAIMRR 387 +G ARTL+P IM R Sbjct: 632 EGLRARTLEPPIMPR 646 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,094 Number of Sequences: 438 Number of extensions: 4296 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -